KEGG   Bacillus subtilis subsp. subtilis 168: BSU17430
Entry
BSU17430          CDS       T00010                                 

Gene name
ynbA
Definition
(RefSeq) GTPase HflX
  KO
K03665  GTPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU17430 (ynbA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  GTPases
   BSU17430 (ynbA)
SSDB
Motif
Pfam: GTP-bdg_N GTP-bdg_M MMR_HSR1 DNA_photolyase FeoB_N G-alpha AbiJ_NTD5
Other DBs
NCBI-GeneID: 938169
NCBI-ProteinID: NP_389625
Pasteur: BG12263
BSORF: BG12263
UniProt: P94478
Position
1875304..1876566
AA seq 420 aa
MNEQETIQEKAILVGCQLPHITDEHFENSMEELASLTKTADGKVLTSVTQKRNRADAATY
IGKGKVEELKALVEELEADLLIFNDELSPSQLKSLATAIEVKMIDRTQLILDIFAKRART
REGKLQIELAQLQYALPRLTGQGINLSRQGGGIGARGPGETKLETDRRHIRNRIHEINTQ
LSTVIRHRSRYRERRKKNGVLQIALVGYTNAGKSTWFNRLTSADSYEEDLLFATLDPMTR
KMVLPSGYSVLLSDTVGFIQDLPTTLIAAFRSTLEEVKEADLILHLIDSSNEDYAGHEKT
VLRLLEELEADDIPMLTAYNKRDQKLPDFIPTAGRDHIMVSAKFEDDAAAFKEAIQRYLR
QELLTSFEAHVPASEGKLLSRIKSETMVDRFYFNEENEQYDISGYVQEEQSIIGELKKYM
NT seq 1263 nt   +upstreamnt  +downstreamnt
ttgaacgaacaagaaacgattcaggagaaagccattttagtcggatgtcagctgccgcat
atcacggatgagcattttgaaaattctatggaagagctagcatctctgacgaaaacagca
gacggaaaagtactgaccagcgtcacacaaaaacggaacagggctgacgccgctacatat
ataggaaaagggaaggtagaagagctgaaggcactcgtggaagagcttgaagctgatctc
ctcatctttaatgatgaactgtcgccaagtcagctgaagtcattggcaacagcaattgaa
gtgaagatgattgaccgcacgcaattgatattagatatttttgcaaagcgggcgagaacg
agagaaggcaaacttcaaattgagctggctcagctgcaatatgcactgccgcgtctgacg
ggacaagggatcaacctttcccggcaaggcggaggaattggggcaagaggtcccggggaa
acgaaactggaaaccgaccgccgccatatcagaaatcgcattcatgaaatcaacacacag
ctttccactgtcattcgccatagaagccgataccgtgaaagaagaaagaaaaacggtgtg
cttcaaattgcgcttgtcggctatacaaacgcagggaaatcaacatggttcaaccgcctg
acgagtgctgacagctatgaagaagacctcctgtttgccacgctggacccgatgaccaga
aaaatggtcctgccaagcggctacagtgttcttctttcagatacagtaggatttattcag
gatcttccgacgacattgattgctgcattccgctcaacgcttgaggaagtaaaagaagcg
gatttaattctgcatttaattgattcttcaaatgaggattatgcgggacatgaaaaaaca
gtgcttcggctgcttgaggagcttgaagcagatgatatcccgatgctgacggcttacaat
aaacgtgatcaaaaactgcctgattttataccgaccgccggaagggatcacattatggtc
agtgcgaaatttgaggacgacgctgcagcctttaaagaagcgattcagcgctatttgcgc
caagaactgttaacgtcttttgaagcacatgtgccggcaagtgaagggaagctcctttcc
agaatcaaatcggaaacgatggtagaccgcttctattttaatgaagaaaatgaacagtat
gacatatccggctatgtccaagaagagcaaagtatcatcggtgaattaaagaagtatatg
tag

DBGET integrated database retrieval system