KEGG   Bacillus subtilis subsp. subtilis 168: BSU18239Help
Entry
BSU18239          CDS       T00010                                 

Gene name
yngHB
Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 RnfC_N HlyD_3 GCV_H PYNP_C PTS_EIIA_1 Peptidase_M23 DUF2118 QRPTase_N NQRA Glyco_trans_1_4 DUF1248
Motif
Other DBs
NCBI-GeneID: 8303012
NCBI-ProteinID: YP_003097733
UniProt: C0H419
Structure
PDB: 

Position
complement(1952945..1953166)
Genome map
AA seq 73 aa AA seqDB search
MTVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVN
EGDVLLELSNSTQ
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgacggttagcatacaaatggcaggaaacctgtggaaagtccacgtcaaagccggcgac
caaatcgaaaagggccaggaggtagccattttggaatcgatgaaaatggaaatcccgatc
gttgcagatagaagcggaatcgtaaaagaagtcaaaaaaaaggaaggcgactttgtaaat
gaaggagacgtactgctcgaactgagcaattccactcaataa

DBGET integrated database retrieval system