KEGG   Bacillus subtilis subsp. subtilis 168: BSU18560Help
Entry
BSU18560          CDS       T00010                                 

Gene name
yoaD
Definition
(RefSeq) 2-hydroxyacid dehydrogenase YoaD
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU18560 (yoaD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU18560 (yoaD)
   00270 Cysteine and methionine metabolism
    BSU18560 (yoaD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU18560 (yoaD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BSU18560 (yoaD)
    1.1.1.399  2-oxoglutarate reductase
     BSU18560 (yoaD)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU18560 (yoaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 NAD_binding_7 AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 940109
NCBI-ProteinID: NP_389738
Pasteur: BG13475
BSORF: BG13475
UniProt: O34815
Position
complement(2024042..2025076)
Genome map
AA seq 344 aa AA seqDB search
MKNTMKRMFCSMTVLVTAPYNEEGRKELENLFGSVAYQSWKEQGRAYREDELIQLLKATN
ATGLITELDQVTDSVFASVPELSFVGVCRGMPSNVDVAAASKRGIPVFYTPGRNAQAVAE
MFIGNVISFLRHTSASNQWLKDGEWDSDYLQAYVKFKGNELTGKTVGMIGFGAVGQRIAK
LLTAFDCKIKYYDPYIQDDHPLYEKASLKTVFSDSDIVSVHLPRTEETLGLIDRQYFDLM
KESAIFVNTSRAVVVNREDLLFVLKEHKISGAILDVFYHEPPEESDYELISLPNVLATPH
LAGATFEVEDHHVTILNKALKKWKGEKTLNIQTMYNKDALKTGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacgatgaaaaggatgttttgcagcatgacggttttggttacagcaccgtac
aacgaagaaggacgaaaagagcttgaaaacttgtttggctcagttgcttatcaatcttgg
aaggaacaaggtagggcatatcgggaggatgaactcattcagctgctaaaagcaacaaat
gcgacaggcttgattactgaacttgatcaggtaacagacagcgtatttgcttctgttccc
gaactttcatttgtcggtgtttgcaggggaatgccctcaaatgtggatgtggcagctgcc
tcaaaaaggggcatacctgttttttatacaccagggcggaatgcacaagccgttgccgaa
atgtttattggaaatgtgatttcctttctgcgccataccagcgcctcgaatcagtggctg
aaggatggagagtgggacagtgattacctgcaggcttatgtcaaatttaaaggaaatgag
ctaacaggaaaaacggttggcatgattgggttcggcgcagtcgggcaaaggattgcaaaa
ctgctgactgcgtttgactgtaagataaaatattacgatccatacattcaagacgatcat
ccgttgtatgaaaaagcatctcttaaaacggtgttttcagacagcgatatcgtttctgtc
catctgcctcgcactgaggaaacactcggactgatagatcggcaatattttgatctgatg
aaagagagtgcgattttcgttaatacttcaagagcagttgttgtaaaccgtgaagatctt
ttatttgtattaaaagaacataaaatcagcggtgcgatactagacgttttttatcatgaa
cctccagaggaatcagattatgaattgatttcattgcctaatgttctggcaacaccgcat
ctcgctggagcaacatttgaagtggaggatcatcacgtgacgatactgaataaagccctc
aaaaagtggaagggtgaaaaaactcttaatattcagacaatgtataacaaggacgcactg
aaaacagggggataa

DBGET integrated database retrieval system