KEGG   Bacillus subtilis subsp. subtilis 168: BSU18740
Entry
BSU18740          CDS       T00010                                 

Gene name
yozG
Definition
(RefSeq) XRE family transcriptional regulator
  KO
K07727  putative transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU18740 (yozG)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU18740 (yozG)
SSDB
Motif
Pfam: HTH_26 HTH_3 HTH_19 HTH_37 HTH_31 HTH_5 HTH_35 HTH_20
Other DBs
NCBI-GeneID: 940003
NCBI-ProteinID: NP_389755
Pasteur: BG13754
BSORF: BG13754
UniProt: O31834
Position
2043678..2043932
AA seq 84 aa
MAIIINIDVMLAKRKMSVTELSERVGITMANLSILKNGKAKAIRLSTLEAICKALECQPG
DILEYRSDEDTGFVKKKYEGSTEK
NT seq 255 nt   +upstreamnt  +downstreamnt
atggcgattattatcaacattgatgtgatgcttgctaagaggaaaatgagcgtaacagag
ctttcagagagagttggcatcaccatggctaatctttcgatattaaaaaacggaaaagca
aaggctattcgattatcaactttagaagcgatttgcaaggctttagaatgtcagcccggg
gatatattggaataccgaagtgatgaagacacaggattcgtaaagaaaaaatatgaagga
tcaacagaaaaataa

DBGET integrated database retrieval system