KEGG   Bacillus subtilis subsp. subtilis 168: BSU18850Help
Entry
BSU18850          CDS       T00010                                 

Gene name
yobD
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 Phage_CI_repr HTH_26 HTH_25 HTH_24 HTH_10
Motif
Other DBs
NCBI-GeneID: 939975
NCBI-ProteinID: NP_389766
Pasteur: BG13497
BSORF: BG13497
UniProt: O34647
Position
2056278..2056616
Genome map
AA seq 112 aa AA seqDB search
MYCQRLRQLRKAHKLTMEQLAEKIGIAKSSYGGYEAESKKPPLDKLVILARLYDVSVDYI
LGLTDDPDPKVERKNLKEFLEKPDIHWDGYKLTPEILDPIRKILKLVTANNN
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtattgccaaagattacggcaattacgaaaggcacacaaattaacaatggaacagtta
gctgagaaaattggaattgcaaaatcaagttacggcgggtatgaagctgaaagcaaaaaa
ccaccattggacaagttggttattttagctagactatatgatgtttcagttgattacata
cttggattaacagatgatcctgatcctaaagtggaaagaaaaaatctaaaagagttttta
gaaaaaccagatattcactgggatggatataaacttacccctgagatattagatcctata
cggaaaattttgaagttggttactgcaaacaacaattaa

DBGET integrated database retrieval system