KEGG   Bacillus subtilis subsp. subtilis 168: BSU18910
Entry
BSU18910          CDS       T00010                                 

Gene name
rapK
Definition
(RefSeq) response regulator aspartate phosphatase K
  KO
K06369  response regulator aspartate phosphatase K [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU18910 (rapK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU18910 (rapK)
SSDB
Motif
Pfam: RapH_N TPR_12 TPR_8 TPR_10 TPR_1 TPR_2 TPR_16 TPR_MalT
Other DBs
NCBI-GeneID: 939604
NCBI-ProteinID: NP_389772
Pasteur: BG12664
BSORF: BG12664
UniProt: O34930
Position
2062150..2063265
AA seq 371 aa
MSKIASEVVATTLNDWYIAIKKQKVDESIKYYSEIKKLFDEMEEDQEVLAYYSLLEERHK
MLLHSSRGEPLQKHTYFTEDNQNFITKTNDKLEYNFYLFEAMYEAYNKNYDRAINLYGLA
EKKLAEIPDEIEAAEFYSKVSYLYTLVKQSIVAQHYIKNAISIYKRHPDYKCKLATSTMI
AAANYADMKRFEEAEQYYLEAIDIAKETKDEFLKAQLFHNLSIVYSDWNKPDKCIESLEK
AIGNESWLHSIYYINSLFMMIKELFKIDEKMKAINFYNKAQERLILMENKVYEAKISILY
NLYCGELKNNFNNCISNIEFLKQQNELESVDELSYIAAKRFESIGAFEEATSFFNAKIWA
EQKMNQVEGIL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgagtaagatcgcttctgaagttgtcgctactacactgaatgactggtacattgctata
aaaaaacaaaaggttgatgaatcaataaaatattattcagagataaagaaactttttgat
gaaatggaagaagatcaagaagttcttgcgtattatagtctattagaagaaagacataaa
atgttgctgcattcttcacgaggagagcctttacaaaagcacacctattttactgaagac
aatcaaaacttcataacaaaaacaaatgataaattagaatacaacttttatttatttgaa
gcaatgtacgaggcatacaacaaaaactatgatcgagcaattaacctatatggattagct
gagaaaaagcttgcagaaattccagatgaaattgaagcagctgaattttactctaaagtc
tcttacttatatactcttgttaaacaaagcattgtggcacaacattatataaaaaatgca
atttcaatatataagcgacaccctgattataaatgcaaactagctacatcaacaatgatt
gcagctgcaaactatgctgatatgaaacgatttgaggaagcagaacaatattacttagaa
gcaattgatattgcaaaagaaacaaaagatgaatttttaaaagctcaattatttcacaat
cttagtatcgtttattctgattggaacaaacctgataaatgcattgaatctcttgaaaaa
gcaataggaaatgaatcttggttacattcgatttattatataaattctttattcatgatg
attaaagaactctttaaaattgacgaaaaaatgaaagccattaatttttacaataaagca
caggaaagactcatattaatggagaataaagtatacgaagccaaaatcagcatcctgtat
aacctttattgtggggaattaaaaaataatttcaataattgtattagtaatattgagttt
ttaaaacagcaaaatgaacttgaaagtgtagatgaattgtcctacatagctgcaaaaagg
tttgaatcaataggtgcttttgaagaagcaacgagctttttcaatgcgaaaatttgggct
gaacagaaaatgaatcaggtggagggaatcttatga

DBGET integrated database retrieval system