KEGG   Bacillus subtilis subsp. subtilis 168: BSU18970
Entry
BSU18970          CDS       T00010                                 

Gene name
yobI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: KAP_NTPase AAA_22 AAA_16 TniB AAA_7 ABC_tran AAA_29 Hrs_helical AAA_14
Other DBs
NCBI-GeneID: 939615
NCBI-ProteinID: NP_389778
Pasteur: BG13501
BSORF: BG13501
UniProt: O34784
Position
complement(2065424..2069029)
AA seq 1201 aa
MGEIKKKFVQWLEKLLIRLKEPNVKEESLFEDLSPSNDVDTDGKYSKALSWGLENKKVKN
IALTGPYGSGKSSILNTFQKQYSREYSFLNISLATFNTDTDDMENKLEKSILQQMIYRVH
DRTIPFSRFKRIKHIRTKSIIINLIFFFAFIIVGIYLFKPDALKGIYAETLVSRSLGTED
QQQIRLTILLALFFIVYPLLAYKRIYHFVRANLKLNKVTIANTTLEKNTGEENSSIFDKY
LDEILYFFEASKYNVVIFEDLDRFNNIGIFERLRELNELINNSEQIDRRVVFIYAIKDDI
FGDADTEKLTRDRTKFFDFIIPVIPIINASNSGDILKKKIKHSPYSDLINTHFLEDVTIY
IDDMRVLKNIFNEFVIYQQKLSAIDLDPNKMLAMIIYKNIYPVDFSKLQYNKGLVYEIFQ
KKQLIIEEQIKLINAKIQQLERKLANIEVESLKSIAELNFIYLSELEISNLNSNYDINID
GEVFRGNTSNKDRFFEKLKNADTIYCYLRNRNGPATIKEIATVFGRKPNYFEREDAIKAI
EKNEIQKFKKELLELEREKQEIRAQSLQVLITKMNSKDVFSDKLYEKKLLVYLLRHGYID
EMYNHYITYFYPESLSLSDIKFVFSIKNHESLPYSFELDNIGKIMSKLVGAEFKQIEVLN
FHLLNYIMDHSEYRNYYDSIIERLANGSKESVTFIDGFKERAINKAAFIQSISSKWDDFW
SFIELRSNYTQQKKEEYLSDILTYADIADIIRMNKESVMSFTLSKYLNLLSLVSDEEKIK
ELLLKLQVKFKSLDHLLNSETIYDFVVQRNLYEINIKTLSVILNDAPNITYAAVKNSDQQ
AVINYVNDNIDIFVEKVLLTEEIEEPEESFLELLNREDLDKRVKHAMIMKKTFAISDIGE
LIKELWPIVIRENKMVACWSNVITSYVEYNKKMPDFLIAFLNNPVNRKELSKNNIEAFDD
KFDEAILEDISEEIINSRDITDETFEVLIASIQSWIYFPLGNVSEKRAKLLIDNDLLSLT
PENFKELKLNFDTLHIQLALRNPDEFIDKQGDFSLDANDIKQLIDSNELSQFNKEIFVQH
LNSNCLTDGNNDILKDTIYFINEHNLKITNELLTFLLESPTTLDTRLSLLAGQIKHIDNE
SITEFLTKIGEPYSEIAEKGRRIKISNNRTNKALVTALESKNYISSFKEDRERLRVNTKK
K
NT seq 3606 nt   +upstreamnt  +downstreamnt
ttgggggaaatcaaaaaaaaatttgtgcagtggttagagaaacttctgattagactaaaa
gaacctaatgttaaggaagaaagcctttttgaagatctttctcctagcaatgatgtcgac
actgatggaaaatattctaaagcactaagttgggggttagaaaataaaaaagtgaaaaat
atcgccctaactggtccctacgggtctggaaaaagtagcatattaaatacctttcaaaaa
caatacagcagggaatatagtttcttaaatatatccttagctacattcaacacagatacg
gatgatatggagaataagttagagaaaagcatcttgcaacaaatgatataccgggtacac
gatagaaccattcccttttctaggtttaaaagaattaagcatataaggactaagagcata
attataaatttgattttcttttttgcatttattatagttggcatctacctttttaaacct
gatgcacttaaaggaatatatgctgagacgttagtttcaaggagtctcggtactgaagat
cagcaacaaatacgactgactatattattagcactgttctttatagtatatcctctactc
gcatataaaagaatttatcattttgtccgtgccaacttaaaattgaataaggttacaatt
gctaatacaacgttagaaaaaaatacaggggaagaaaactcttctatatttgataaatat
ttagatgaaatattatatttttttgaagcctccaagtataatgttgtaatatttgaggac
ttagatcgctttaataatataggtatttttgaaagattaagagaattaaatgaacttata
aataattcagaacaaatagatagacgtgttgtttttatatatgcgataaaagatgatatt
tttggagatgcagacactgaaaagttaactagagaccgcacaaaattttttgattttatt
atcccagtaataccaattattaatgcatctaattcaggagacatacttaaaaagaaaata
aaacattcaccatattctgatttgataaacactcatttcttagaggatgtaacaatttac
attgatgacatgagagtattaaagaatatttttaatgaatttgttatataccaacaaaaa
ctaagtgcaattgatcttgatcctaacaaaatgttagcaatgataatctacaaaaatatt
tatcctgtggatttttctaaattacaatataacaaagggttggtatatgaaatctttcaa
aaaaaacaacttataattgaggaacaaataaaattaattaatgctaaaatacaacaatta
gagaggaaattagcgaatatagaagttgagtctttaaaatcaattgctgaattaaatttt
atatacttgagcgaattagaaatatcaaatttgaattctaattatgatattaatatagat
ggcgaggtatttagaggcaatacatctaataaagatcggttttttgagaagttaaaaaat
gcggatactatctattgttatttaagaaatagaaatggtccagcgacaattaaagaaatt
gcaactgtttttggtcggaaaccgaactactttgaaagagaagatgccatcaaggctata
gagaaaaatgaaatccaaaaattcaagaaagaactattggaattagagagagaaaagcaa
gaaataagagcgcaatctttacaagtattaattacaaaaatgaattcaaaggatgtattt
tctgataagctttacgagaaaaaattacttgtttacctgctacgtcatggatatattgat
gaaatgtataaccattacatcacttacttctatccagaaagtttaagtctttccgatatt
aaatttgtatttagtattaaaaaccacgagtcattgccttacagctttgagctggataat
atcggtaaaataatgagcaaattagttggtgctgaatttaagcaaatagaggtacttaat
tttcatctcttaaactatataatggatcattctgaataccgtaattattatgatagcata
attgagcgacttgcaaatggaagtaaagaatctgttacattcatagatggttttaaagaa
agggcaataaataaagctgcctttatccaatcgatatctagtaaatgggatgatttttgg
agttttattgaacttagatccaattatacacaacagaaaaaagaggaatacttgtcagat
atacttacatatgctgatatagctgatattatccgaatgaataaagagtcggtcatgtct
ttcacattatccaagtacttaaatcttctcagcttagtatctgatgaggagaaaataaaa
gaactactattaaaactccaagttaaatttaaaagtttggatcatttgctaaattctgaa
acaatatatgactttgttgttcaacgaaatctatacgaaattaatatcaaaactttatca
gttattttaaatgatgctcccaatataacgtatgctgcagttaaaaactctgatcagcag
gctgttatcaattacgtaaatgacaatattgatatatttgttgaaaaagttttacttact
gaggagattgaggaaccagaggaaagttttctggagttattaaatcgggaggatttagat
aagagagtaaagcatgcaatgatcatgaaaaaaacttttgccatctcggatattggtgaa
ttgattaaagagttatggccaattgtgatccgtgaaaataaaatggttgcatgctggtca
aacgttattacttcttatgtagaatacaataaaaaaatgcctgatttcttaatagctttc
ttaaacaatcctgttaatagaaaagagctctctaaaaataatatagaggcgtttgatgat
aaatttgacgaagcgattttagaagatatctcagaagaaatcattaatagtcgggatatt
acagacgaaacattcgaagtgttaattgctagtattcaaagttggatttactttccgctc
ggaaatgttagtgaaaaaagagcaaaattattgattgataatgatttgttatctctaaca
ccggaaaattttaaagagttaaaattaaattttgatacacttcatatccaactcgctttg
agaaaccctgacgagtttattgataaacaaggtgatttttcccttgatgccaatgatata
aagcaactcatagatagcaacgagctctctcaatttaacaaagaaatatttgtacaacat
ttaaattctaactgtttgacagatggaaataatgatattcttaaagatacaatttatttt
attaatgagcataacctgaaaatcaccaatgaactactaacctttttgcttgaatcacct
acaacattggatactaggttatcgttgctagctggacaaataaagcatattgataatgaa
tcaattactgaatttttaactaaaataggggaaccttactctgaaattgctgaaaaaggc
agacgaataaagatctcaaataatagaactaataaagcgttggtgactgcattagagtct
aaaaactacatatcctcttttaaagaagatagagagagattacgtgtgaatactaaaaaa
aaataa

DBGET integrated database retrieval system