KEGG   Bacillus subtilis subsp. subtilis 168: BSU19210
Entry
BSU19210          CDS       T00010                                 

Gene name
yocH
Definition
(RefSeq) cell wall-binding protein YocH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysM 3D OapA DDHD LPAM_1
Other DBs
NCBI-GeneID: 939673
NCBI-ProteinID: NP_389802
Pasteur: BG13521
BSORF: BG13521
UniProt: O34669
Position
complement(2092899..2093762)
AA seq 287 aa
MKKTIMSFVAVAALSTTAFGAHASAKEITVQKGDTLWGISQKNGVNLKDLKEWNKLTSDK
IIAGEKLTISSEETTTTGQYTIKAGDTLSKIAQKFGTTVNNLKVWNNLSSDMIYAGSTLS
VKGQATAANTATENAQTNAPQAAPKQEAVQKEQPKQEAVQQQPKQETKAEAETSVNTEEK
AVQSNTNNQEASKELTVTATAYTANDGGISGVTATGIDLNKNPNAKVIAVDPNVIPLGSK
VYVEGYGEATAADTGGAIKGNKIDVFVPSKSDASNWGVKTVSVKVLN
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaagaagacgattatgtcctttgtggcagttgctgcactttcaacaactgcattcgga
gctcacgcttctgcaaaagaaattacggtgcaaaagggtgatacgctctggggaatctct
cagaaaaatggagtgaacctaaaggacttaaaagaatggaacaagttaacttctgataaa
atcattgcaggagaaaaactgaccatttcttcagaagaaacaaccacgactgggcaatat
acaattaaagcgggagatacgctttctaagattgctcaaaaattcggcacgacagtcaac
aacctgaaagtttggaataacttaagctctgacatgatctatgctggatcaactctttca
gtaaaaggtcaggcaacagcagcaaacacagctactgagaatgcgcaaacaaacgcacct
caagctgcgccaaaacaagaggctgtgcaaaaagagcaacctaaacaagaagctgtacaa
cagcaacctaaacaagaaacaaaggctgaggcagaaacttctgttaacacagaggagaag
gctgttcaatcaaatacaaataatcaagaagcttcaaaagaactaacagttactgctact
gcttacactgctaacgacggcggcatttccggcgttacagctacaggcattgacttaaat
aagaacccgaacgcgaaagttattgcggttgatcctaatgtaattccgctaggttctaaa
gtctatgttgaaggctacggggaagcaacagcagcagacactggcggcgctattaaagga
aataaaatcgacgtatttgtaccaagtaaaagtgatgcttctaattggggcgtcaaaact
gtaagtgttaaagtcttaaactaa

DBGET integrated database retrieval system