KEGG   Bacillus subtilis subsp. subtilis 168: BSU19220Help
Entry
BSU19220          CDS       T00010                                 

Gene name
yocI
Definition
(RefSeq) ATP-dependent DNA helicase RecQ
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU19220 (yocI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU19220 (yocI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU19220 (yocI)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU19220 (yocI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RQC HRDC Helicase_C DEAD RecQ_Zn_bind ResIII Helicase_Sgs1
Motif
Other DBs
NCBI-GeneID: 939671
NCBI-ProteinID: NP_389803
Pasteur: BG13522
BSORF: BG13522
UniProt: O34748
Position
complement(2094010..2095785)
Genome map
AA seq 591 aa AA seqDB search
MLHRAQSLLAHYFGYEKFRSGQDEAIRLVTEARQNTACIMPTGGGKSICYQIPALMFEGT
TIVISPLISLMKDQVDALEEAGINAAYINSTQSNQEIYERLNGLKEGAYKLFYITPERLT
SIEFIRILQGIDVPLVAIDEAHCISQWGHDFRPSYRNIEILFRELHDKPVIMALTATATP
EVHDDICKQLHIQKENTVYTGFSRENLTFKVVKGENKDRFIDEYVQNNRHEAGIVYTATR
KEADRIYERLKRNQVRAGRYHGGLADDVRKEQQERFLNDELQVMVATSAFGMGIDKSNIR
FVLHAQIPKDMESYYQEAGRAGRDGLASECVLLFSPQDIMVQRFLIEQSEHEEKQKQDLK
KLRQMVDYCHTEDCLQRFILMYFGEKEPDACGQCGNCTDTRAAHDVTREAQMVLSCIIRM
KERFGKTMVAQVLAGSKNKKVLENGFSDLSTYGILKHQSVGEISDFIEFLISDDFIRMSD
GTFPTLFVSSKGRNVLKGELSVARKEALKAAAITENDELFERLRMVRKEIAAEQGVPPFV
VFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYGRLFLQEIQAYARMTD
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgttacatagagcccaatcccttctggctcattattttggttatgagaagtttcggagc
ggccaagatgaagcgatccgcttggtgacggaagcgaggcaaaatacggcctgcattatg
ccgacgggaggcggcaaatcgatttgctatcagattccggcattaatgtttgaagggacg
acgatcgtcatttcaccgttgatttccttgatgaaggatcaagttgatgcgttagaagaa
gcggggattaacgccgcctacattaacagcacacaatccaatcaggaaatatatgagagg
ctgaacggactcaaagaaggggcttataagcttttttacattacaccagagcgactaacg
tccatagagtttatccggattttgcagggcatagatgttcctttggtcgcaatagacgag
gcgcattgtatttctcaatggggccatgatttcaggccaagctacaggaatattgaaatc
ttgttccgtgaattacacgacaagcctgtcatcatggcgttaacagcaacagccacaccc
gaggttcatgatgatatttgcaaacagctgcatattcaaaaagaaaacacggtatatacc
ggattttcccgagagaatttaacctttaaagtagtaaaaggagaaaataaagatcggttt
atagacgaatatgtgcaaaacaacaggcatgaagcaggaattgtctatacagcgaccaga
aaagaagctgatcggatatatgagagattgaaacgaaatcaggtcagggcaggccggtat
catggaggtttggctgatgatgtgagaaaagagcagcaggaaagatttcttaatgatgag
cttcaagtgatggtggcaacctctgcttttggaatgggtattgataaatcaaatatcaga
tttgttctgcatgcacaaatcccgaaagatatggaaagctattatcaagaggcaggacga
gctggacgggacggtcttgccagtgaatgtgttctcctgttttcaccgcaggatattatg
gtgcagcgcttcttaattgagcaatcagaacatgaagagaaacaaaagcaggatttaaaa
aagctgagacaaatggtcgactactgtcatacggaagattgtctgcagcgttttatcctt
atgtatttcggagaaaaggagcctgatgcgtgcggacagtgcggaaactgtaccgataca
agagcggcccatgacgtgacgcgggaggcgcaaatggtcttatcttgtatcattcgcatg
aaagaacggtttggcaagacgatggttgcccaggtgcttgccggctccaaaaataaaaaa
gttcttgaaaacggcttttccgacctttcaacatacgggatattaaaacaccaatccgtt
ggcgaaatcagtgattttatcgaatttcttatttctgacgacttcatcaggatgtcagac
ggaacgtttccgactctttttgtcagcagtaaaggaaggaatgtgctgaaaggagaatta
tcagtagcgagaaaagaagcgttaaaagcggcagcgattactgaaaatgacgagctattt
gaacgattgcgcatggttcggaaagaaattgcggctgagcagggtgttccgccatttgtt
gttttctctgaccaaacgttaaaagaaatgtcaggaaaacagcccgtaaatgatgatgaa
cttttgtctataaaaggagtcggagaacaaaaaagagcaaaatacggccggcttttttta
caagaaatacaggcttatgcaaggatgacagactaa

DBGET integrated database retrieval system