KEGG   Bacillus subtilis subsp. subtilis 168: BSU19560
Entry
BSU19560          CDS       T00010                                 

Gene name
yodD
Definition
(RefSeq) hydrolase MhqD
  KO
K06999  phospholipase/carboxylesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    BSU19560 (yodD)
SSDB
Motif
Pfam: DLH Hydrolase_4 Abhydrolase_2 Peptidase_S9 Abhydrolase_6 FSH1 Abhydrolase_3 Esterase_PHB Abhydrolase_1 Abhydrolase_4 Ndr
Other DBs
NCBI-GeneID: 940106
NCBI-ProteinID: NP_389837
Pasteur: BG13533
BSORF: BG13533
UniProt: O34842
Position
complement(2128464..2129066)
AA seq 200 aa
MKHIYEKGTSDNVLLLLHGTGGNEHDLLSLGRFIDPDAHLLGVRGSVLENGMPRFFKRLS
EGVFDEKDLVVRTRELKDFIDEAAETHQFNRGRVIAVGYSNGANIAASLLFHYKDVLKGA
ILHHPMVPIRGIELPDMAGLPVFIGAGKYDPLCTKEESEELYRYLRDSGASASVYWQDGG
HQLTQHEAEQAREWYKEAIV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaagcatatttatgagaaaggaacatctgacaacgtacttttgctgttgcatggcacg
ggtggtaatgaacacgatctgctttcattggggcggtttatagaccctgatgcccatttg
cttggtgtcagaggatcggtgcttgaaaatggaatgccgcgatttttcaaacgtctgagt
gaaggagtttttgatgaaaaggatcttgtggtgcggacaagagaattgaaagattttatc
gacgaggctgcagaaacgcatcagtttaatcgcggccgagtgattgcagtcggttattca
aacggcgcaaacattgcggcaagcctgctttttcattataaagatgtgttaaaaggggct
attctgcatcatccaatggttccgattcggggtatcgagctgcctgatatggcggggctc
cctgtttttatcggtgccgggaaatacgatcctctttgcacgaaggaagaatcagaagag
ctttaccgctatttgcgtgacagcggggcatcagcctccgtttactggcaggacgggggc
catcagctgactcagcatgaagctgaacaggctcgtgaatggtacaaagaggcgattgta
taa

DBGET integrated database retrieval system