KEGG   Bacillus subtilis subsp. subtilis 168: BSU19590
Entry
BSU19590          CDS       T00010                                 

Gene name
ctpA
Definition
(RefSeq) carboxy-terminal processing protease CtpA
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU19590 (ctpA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     BSU19590 (ctpA)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S41: C-terminal processing peptidase family
   BSU19590 (ctpA)
SSDB
Motif
Pfam: Peptidase_S41 PDZ_6 PDZ PDZ_2 PG_binding_1 DUF3394 Sipho_tail Mst1_SARAH Arc_PepC_II Bac_rhamnosid6H HP0268
Other DBs
NCBI-GeneID: 940115
NCBI-ProteinID: NP_389840
Pasteur: BG11794
BSORF: BG11794
UniProt: O34666
Position
complement(2131902..2133302)
AA seq 466 aa
MKRQLKLFFIVLITAVVASALTLFITGNSSILGQKSASTGDSKFDKLNKAYEQIKSDYYQ
KTDDDKLVDGAIKGMIQSLDDPYSTYMDQEQAKSFDETISASFEGIGAQVEEKDGEILIV
SPIKGSPAEKAGIKPRDQIIKVNGKSVKGMNVNEAVALIRGKKGTKVKLELNRAGVGNID
LSIKRDTIPVETVYSEMKDNNIGEIQITSFSETTAKELTDAIDSLEKKGAKGYILDLRGN
PGGLMEQAITMSNLFIDKGKNIMQVEYKNGSKEVMKAEKERKVTKPTVVLVNDGTASAAE
IMAAALHESSNVPLIGETTFGKGTVQTAKEYDDGSTVKLTVAKWLTADGEWIHKKGIKPQ
VKAELPDYAKLPYLDADKTYKSGDTGTNVKVAQKMLKALGYKVKVNSMYDQDFVSVVKQF
QKKEKLNETGILTGDTTTKLMIELQKKLSDNDTQMEKAIETLKKEM
NT seq 1401 nt   +upstreamnt  +downstreamnt
ttgaaacggcaattaaaactgttttttattgtgctgatcactgcagttgtcgcttcggcg
cttactttatttattacgggcaattccagtatcctgggccaaaaatcagcaagcacagga
gacagcaagttcgacaaattaaataaagcgtatgagcaaatcaaaagtgattattaccaa
aaaacagatgatgacaaattagtagacggagcaattaaaggaatgattcaatcactggat
gatccgtattctacatatatggatcaagagcaagcgaaatcattcgacgagacgatttca
gcatcttttgaaggaatcggagcccaagtagaggagaaagacggagaaatccttattgta
tccccaattaaaggttcacctgctgaaaaagccggtatcaaaccgagggaccaaatcatt
aaggtaaatggaaaaagcgtaaaaggcatgaatgtaaatgaagccgtcgctttaatccga
ggcaaaaagggcacaaaggtgaagcttgaactgaacagagcgggagtggggaatatcgat
ctttccattaagcgcgataccattcctgtagagactgtctattcagagatgaaagacaac
aacatcggagaaattcaaatcacttctttctctgaaacaacagctaaagagctgacagat
gcgattgacagtttagagaaaaaaggcgccaaaggctatattttagacttgagaggcaac
ccgggcggcttaatggaacaggcgattacgatgagcaacctgttcattgataaagggaaa
aacatcatgcaggttgaatacaaaaacggttcaaaagaagtcatgaaggccgaaaaagaa
cggaaagtgaccaagccgaccgtcgttttagtaaatgacggtacagcaagcgcagccgaa
attatggccgctgcccttcatgaatcgtcaaacgtaccgttaatcggcgagacgacattc
ggcaaaggtacagtacaaacggcaaaagaatatgatgatggctctaccgtcaaactgaca
gttgccaaatggctgactgctgatggcgaatggattcacaaaaaaggcatcaagcctcaa
gtgaaagcagagctgcctgattacgcgaagctgccgtatttggacgcagataaaacgtac
aaatcaggtgatacaggcacaaacgtcaaagtggctcagaaaatgctcaaagcacttggt
tacaaggtaaaggttaacagtatgtatgaccaggattttgtatctgtcgtcaaacagttc
cagaaaaaagagaagctgaatgaaacaggcatactgactggcgatacaacaacgaaatta
atgatagaacttcaaaagaagctgtctgataatgatacgcaaatggaaaaggcaattgaa
acactgaaaaaagaaatgtaa

DBGET integrated database retrieval system