KEGG   Bacillus subtilis subsp. subtilis 168: BSU19840
Entry
BSU19840          CDS       T00010                                 

Gene name
yotL
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_26 HTH_3 HTH_19 NADPH_Ox
Other DBs
NCBI-GeneID: 940077
NCBI-ProteinID: NP_389865
Pasteur: BG13745
BSORF: BG13745
UniProt: O31865
Position
2152927..2153169
AA seq 80 aa
MKKQWKPVDSRLNELMHEYSVSIEDLVECTGLSKQRINDYVGGFKSNMNIGTAMTFADAI
GCSIEELYVWNFKERRQLTK
NT seq 243 nt   +upstreamnt  +downstreamnt
gtgaaaaaacaatggaaaccagttgattcaagactcaatgagctcatgcatgaatatagc
gtttcaattgaagatcttgttgaatgtactggattatcaaaacaacgtattaatgattat
gtaggtggttttaaatcaaatatgaatattggaacagcaatgacatttgctgatgccata
ggttgctctatagaagagctttatgtatggaactttaaagagcgcagacaattaaccaaa
taa

DBGET integrated database retrieval system