KEGG   Bacillus subtilis subsp. subtilis 168: BSU20080
Entry
BSU20080          CDS       T00010                                 

Gene name
yosL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PBP-Tp47_a
Other DBs
NCBI-GeneID: 939559
NCBI-ProteinID: NP_389890
Pasteur: BG13721
BSORF: BG13721
UniProt: O31877 A0A6M4JNE8
Position
complement(2165972..2166325)
AA seq 117 aa
MGAARRIDPTQPYVKKKNIINFTVATENTHIHLADGQSFPVLKGEIIATDQQGNQFVELE
KNLDDYVPVKKSSLYESMAQGYMEMGDINREISEAFNYAENEAETVTTKLITGAYND
NT seq 354 nt   +upstreamnt  +downstreamnt
atgggggcagctagacgtattgatccaactcaaccatatgtaaaaaagaagaacattatt
aactttacagtagccactgagaacactcatattcatttagctgatgggcaatctttccct
gtattaaaaggagagattattgcaactgaccaacaaggaaatcaatttgttgaattagaa
aagaatctagatgattacgttccagttaagaaaagttccttatatgaaagtatggcacag
ggctacatggaaatgggcgacattaatcgtgagatatcagaagcattcaattacgctgaa
aatgaagctgaaacagtgactacaaaattaattacaggggcttataacgattag

DBGET integrated database retrieval system