KEGG   Bacillus subtilis subsp. subtilis 168: BSU20500Help
Entry
BSU20500          CDS       T00010                                 

Gene name
ligB
Definition
(RefSeq) DNA ligase-like protein LigB
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03410  Base excision repair
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU20500 (ligB)
   03410 Base excision repair
    BSU20500 (ligB)
   03420 Nucleotide excision repair
    BSU20500 (ligB)
   03430 Mismatch repair
    BSU20500 (ligB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU20500 (ligB)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU20500 (ligB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSU20500 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSU20500 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSU20500 (ligB)
DNA replication proteins [BR:bsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSU20500 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSU20500 (ligB)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSU20500 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     BSU20500 (ligB)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU20500 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase mRNA_cap_enzyme Vps54
Motif
Other DBs
NCBI-GeneID: 939992
NCBI-ProteinID: NP_389932
Pasteur: BG13680
BSORF: BG13680
UniProt: O31917
Position
2192370..2193182
Genome map
AA seq 270 aa AA seqDB search
MFVSPMLLHSIKEPFNDENYITELKFDGIRLILSKFDNQIKLYTRHNNEVTSKFPELMDL
DIPDGTVLDGEVIVAASGGAPDFEAVMERFMSKKSAHNIVYCVFDVIYKDGQSIAAKPLT
ERKTVLNSLELDHPNVFVIEGTQGNGLAYFNLAKEKNLEGIVIKKANSPYEINKRSHNWL
KVINYDYTEVLITGYTKKDIKFLLSYPDGTSAGFMEFMPHAERTKFHSMKQVKSESDEYV
FIEPILCNVKHRFKTKHGKLRIPSFESWRV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtatcgccaatgctattgcattcaataaaagagccttttaacgacgagaactat
atcactgagctcaaatttgatggaatcagactcatcctttctaaatttgataatcagatt
aagctatacactcgtcacaacaacgaagtaacaagtaagttcccagaactcatggactta
gatattccagatggaacagtgctcgatggtgaagttattgtagctgcctcaggtggtgct
cctgactttgaggctgtaatggaacgttttatgtccaaaaaatcagctcataatattgtt
tactgtgtctttgatgttatctacaaagacggtcaatcaattgcagctaagccactcact
gagcgtaagacagttctgaattcacttgaactggatcatcctaatgtctttgttatagag
ggaactcaaggtaacggtcttgcttacttcaacctggccaaagaaaagaatttagaggga
atcgtaatcaagaaagctaactccccttatgagatcaataaacgttcgcataattggctt
aaagtgattaattacgattacactgaggttctcataactggctacaccaaaaaggatata
aaattccttctgtcttatcctgatggaacttcagctggatttatggaatttatgccacat
gcagaacgaactaagttccactctatgaaacaagttaagtctgaatctgatgaatatgta
tttatcgaacctatcttatgtaacgttaagcacagatttaagactaagcacggtaaactc
cgcataccttcctttgaatcctggagagtgtaa

DBGET integrated database retrieval system