KEGG   Bacillus subtilis subsp. subtilis 168: BSU20500
Entry
BSU20500          CDS       T00010                                 
Symbol
ligB
Name
(RefSeq) DNA ligase-like protein LigB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DNA_ligase_A_M RNA_ligase mRNA_cap_enzyme Vps54
Other DBs
NCBI-GeneID: 939992
NCBI-ProteinID: NP_389932
Pasteur: BG13680
UniProt: O31917 A0A6M3ZCH3
Position
2192370..2193182
AA seq 270 aa
MFVSPMLLHSIKEPFNDENYITELKFDGIRLILSKFDNQIKLYTRHNNEVTSKFPELMDL
DIPDGTVLDGEVIVAASGGAPDFEAVMERFMSKKSAHNIVYCVFDVIYKDGQSIAAKPLT
ERKTVLNSLELDHPNVFVIEGTQGNGLAYFNLAKEKNLEGIVIKKANSPYEINKRSHNWL
KVINYDYTEVLITGYTKKDIKFLLSYPDGTSAGFMEFMPHAERTKFHSMKQVKSESDEYV
FIEPILCNVKHRFKTKHGKLRIPSFESWRV
NT seq 813 nt   +upstreamnt  +downstreamnt
ttgtttgtatcgccaatgctattgcattcaataaaagagccttttaacgacgagaactat
atcactgagctcaaatttgatggaatcagactcatcctttctaaatttgataatcagatt
aagctatacactcgtcacaacaacgaagtaacaagtaagttcccagaactcatggactta
gatattccagatggaacagtgctcgatggtgaagttattgtagctgcctcaggtggtgct
cctgactttgaggctgtaatggaacgttttatgtccaaaaaatcagctcataatattgtt
tactgtgtctttgatgttatctacaaagacggtcaatcaattgcagctaagccactcact
gagcgtaagacagttctgaattcacttgaactggatcatcctaatgtctttgttatagag
ggaactcaaggtaacggtcttgcttacttcaacctggccaaagaaaagaatttagaggga
atcgtaatcaagaaagctaactccccttatgagatcaataaacgttcgcataattggctt
aaagtgattaattacgattacactgaggttctcataactggctacaccaaaaaggatata
aaattccttctgtcttatcctgatggaacttcagctggatttatggaatttatgccacat
gcagaacgaactaagttccactctatgaaacaagttaagtctgaatctgatgaatatgta
tttatcgaacctatcttatgtaacgttaagcacagatttaagactaagcacggtaaactc
cgcataccttcctttgaatcctggagagtgtaa

DBGET integrated database retrieval system