KEGG   Bacillus subtilis subsp. subtilis 168: BSU20780
Entry
BSU20780          CDS       T00010                                 

Gene name
yopS
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_26 HTH_3 HTH_37 CPSase_L_D3 MerR_1 HTH_35 HTH_10 HTH_24
Other DBs
NCBI-GeneID: 939428
NCBI-ProteinID: NP_389960
Pasteur: BG13652
BSORF: BG13652
UniProt: O34766 A0A6M4JN16
Position
2203779..2204003
AA seq 74 aa
MIKVEIGQCLIPELCRKKDITINELSEITGIKKQQLSDYNRLVKVDMSIRTAKRIAAALD
CNVEDLYEFKVERH
NT seq 225 nt   +upstreamnt  +downstreamnt
atgattaaagttgagatcgggcaatgcttgatacctgaattatgtagaaagaaagacatt
acaatcaatgaactttcagagataactgggattaagaaacagcagctgagcgactataat
cgattagttaaagtagatatgtctattcgaactgcaaaaagaattgctgctgctttagat
tgtaatgtcgaagacctctatgaattcaaggttgaaaggcattga

DBGET integrated database retrieval system