KEGG   Bacillus subtilis subsp. subtilis 168: BSU20780Help
Entry
BSU20780          CDS       T00010                                 

Gene name
yopS
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_26 HTH_3 CDO_I HTH_35 HTH_10 HTH_37 MerR_1 CPSase_L_D3 HTH_24 HRDC
Motif
Other DBs
NCBI-GeneID: 939428
NCBI-ProteinID: NP_389960
Pasteur: BG13652
BSORF: BG13652
UniProt: O34766
Position
2203779..2204003
Genome map
AA seq 74 aa AA seqDB search
MIKVEIGQCLIPELCRKKDITINELSEITGIKKQQLSDYNRLVKVDMSIRTAKRIAAALD
CNVEDLYEFKVERH
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttgagatcgggcaatgcttgatacctgaattatgtagaaagaaagacatt
acaatcaatgaactttcagagataactgggattaagaaacagcagctgagcgactataat
cgattagttaaagtagatatgtctattcgaactgcaaaaagaattgctgctgctttagat
tgtaatgtcgaagacctctatgaattcaaggttgaaaggcattga

DBGET integrated database retrieval system