KEGG   Bacillus subtilis subsp. subtilis 168: BSU20820Help
Entry
BSU20820          CDS       T00010                                 

Gene name
yopO
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_26 HTH_19 HTH_35 HTH_25
Motif
Other DBs
NCBI-GeneID: 939435
NCBI-ProteinID: NP_389964
Pasteur: BG13648
BSORF: BG13648
UniProt: O34791
Position
complement(2207748..2207960)
Genome map
AA seq 70 aa AA seqDB search
MSERIKQLMVKRGITIEELSRETMIDMQTLNKIIEMPDESDVTTIKLIALVLNVSIDELL
DEKGGEDNAK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgaataaaacagctaatggtcaaacgtggcatcacaatagaggaattgtcg
agggagacaatgattgatatgcagacattaaacaaaatcattgaaatgccagatgaatca
gatgttacaaccataaagcttatcgctctggtgttgaatgtctctattgatgagttatta
gatgagaaaggaggagaagataatgcaaaataa

DBGET integrated database retrieval system