KEGG   Bacillus subtilis subsp. subtilis 168: BSU20970Help
Entry
BSU20970          CDS       T00010                                 

Gene name
yonX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2046 Baculo_PEP_C DLP_helical DUF4407 Prefoldin_2 Nsp1_C TPR_MLP1_2 FlaC_arch
Motif
Other DBs
NCBI-GeneID: 939173
NCBI-ProteinID: NP_389980
Pasteur: BG13633
BSORF: BG13633
UniProt: O31938
Position
complement(2217133..2217639)
Genome map
AA seq 168 aa AA seqDB search
MNAQLFNLESRLDELENEINTQYCELDTNLDALKSNRIELESQLEKFESSLTNRLQGSIS
NNCRNDLLNLGYTHSQVDCMSDEEVYAALDKIDEEIHNTDQDYSTGFEDLEKQIIEMKRD
YFIDRKERGSGNFDEAWEGEILDLEFEYTVLCLEKGLEPLNYIITWEG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcaactttttaatctggagtctagacttgatgaattggaaaatgaaattaat
acacaatactgtgagttagatactaatcttgatgctcttaaatccaatcgtattgagctg
gaatcacagcttgaaaaatttgagtctagtcttacaaatagattacaaggaagcatttca
aataactgccgaaatgacctgcttaatctgggatacacgcattcacaagttgattgcatg
tctgacgaagaagtttacgctgcactcgataaaattgatgaagaaattcataatactgat
caagattattctacgggatttgaagatcttgaaaaacaaatcattgagatgaagagggac
tatttcattgatcgaaaagaaagagggtcagggaatttcgatgaggcatgggaaggagaa
atccttgatttagaatttgagtacacggttctttgtttagaaaaggggttagaaccactc
aattatattattacctgggaaggatag

DBGET integrated database retrieval system