KEGG   Bacillus subtilis subsp. subtilis 168: BSU20970
Entry
BSU20970          CDS       T00010                                 

Gene name
yonX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2046 Baculo_PEP_C DLP_helical Prefoldin_2 DUF4200 FlaC_arch Nsp1_C MutS_IV
Other DBs
NCBI-GeneID: 939173
NCBI-ProteinID: NP_389980
Pasteur: BG13633
BSORF: BG13633
UniProt: O31938 A0A6M3ZCX3
Position
complement(2217133..2217639)
AA seq 168 aa
MNAQLFNLESRLDELENEINTQYCELDTNLDALKSNRIELESQLEKFESSLTNRLQGSIS
NNCRNDLLNLGYTHSQVDCMSDEEVYAALDKIDEEIHNTDQDYSTGFEDLEKQIIEMKRD
YFIDRKERGSGNFDEAWEGEILDLEFEYTVLCLEKGLEPLNYIITWEG
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaatgcgcaactttttaatctggagtctagacttgatgaattggaaaatgaaattaat
acacaatactgtgagttagatactaatcttgatgctcttaaatccaatcgtattgagctg
gaatcacagcttgaaaaatttgagtctagtcttacaaatagattacaaggaagcatttca
aataactgccgaaatgacctgcttaatctgggatacacgcattcacaagttgattgcatg
tctgacgaagaagtttacgctgcactcgataaaattgatgaagaaattcataatactgat
caagattattctacgggatttgaagatcttgaaaaacaaatcattgagatgaagagggac
tatttcattgatcgaaaagaaagagggtcagggaatttcgatgaggcatgggaaggagaa
atccttgatttagaatttgagtacacggttctttgtttagaaaaggggttagaaccactc
aattatattattacctgggaaggatag

DBGET integrated database retrieval system