KEGG   Bacillus subtilis subsp. subtilis 168: BSU21100Help
Entry
BSU21100          CDS       T00010                                 

Gene name
yonG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RRPl_C4 UPF0167
Motif
Other DBs
NCBI-GeneID: 939165
NCBI-ProteinID: NP_389993
Pasteur: BG13620
BSORF: BG13620
UniProt: O31951
Position
2229988..2230908
Genome map
AA seq 306 aa AA seqDB search
MSAEKIKCSCCGKEQNANQYYISESPFNSATGKLSVCKSCLQNEFQKDKDNLKNVQNILR
MIDRPFVYDLWVSAVNESESKKKSAGNVLGTYMKNIGMKDYKSKTWADSEFDFEEEQEYT
TQLLLAKSTEDISKEDIDELMQFWGRGLDVEDYIWLQNEYIDFTNRYECDSKGMELLINE
ICLTRLDIRKRRENGEKVDQQQKTLQDLLGSSNLKPVQETGASGVEQESFGTLIKKYENE
RPIPEPEPRWKDPDKIGKYIKVFFLGHLSRMLGLKNQYSEEYWEEMNKHTVEEPVAEEED
RENDLT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaaaaataaaatgctcatgctgcggcaaagaacaaaatgccaatcaatat
tatatatcggaatctcctttcaattctgcaacaggcaaactgtcagtatgtaagagctgt
ctccaaaatgaattccaaaaagacaaagataacttaaagaatgttcaaaacatcttaaga
atgattgaccgtccttttgtttacgacttgtgggtttccgctgttaatgaatcagagtcc
aagaaaaaatcagctggaaatgtgttaggtacttatatgaaaaatatcggaatgaaagat
tacaagtcaaaaacttgggcagacagtgagtttgactttgaagaagaacaagaatataca
acacaattgttactagctaaaagtacagaagatatatctaaggaagacatagatgaatta
atgcaattctggggtcgtggtcttgatgttgaagattatatttggcttcagaatgagtac
attgacttcacgaataggtatgaatgcgactctaagggaatggaacttcttataaatgaa
atatgtttgactcggctagatatacgcaaacggcgtgaaaatggtgaaaaagtcgatcag
cagcaaaaaactcttcaagatttacttgggtcaagtaatttaaaacccgttcaagaaact
ggagcaagtggagttgaacaagagtcttttggcactctgatcaaaaaatatgagaatgag
agacctattcctgagccagagcctagatggaaagatcctgataaaatcgggaaatacatt
aaggtatttttccttgggcatctgtctcgaatgcttggtttgaaaaatcaatattcagag
gaatattgggaagaaatgaataagcatactgttgaagaacctgttgcagaagaagaggat
cgagaaaatgacctcacataa

DBGET integrated database retrieval system