KEGG   Bacillus subtilis subsp. subtilis 168: BSU21410Help
Entry
BSU21410          CDS       T00010                                 

Gene name
blyA
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase BlyA
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU21410 (blyA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU21410 (blyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2 SH3_3
Motif
Other DBs
NCBI-GeneID: 939130
NCBI-ProteinID: NP_390024
Pasteur: BG13590
BSORF: BG13590
UniProt: O31982
Position
2263489..2264592
Genome map
AA seq 367 aa AA seqDB search
MSVFTNSYIPVNKYTRPGLKLQGVKKCVLHYTANPGAGADNHRRYFSNAQVYASAHIFVD
KAEAICIIPLNEVAYHANDIQQRDSAGNPYRGVAALKPNANFLSIGVEMCLEKDGSFHSD
TVERTEDVFVELCNKFGLDPIDDIVRHYDITHKNCPAPWVSNSQKFVDFKNRVKAKMSGK
SVSKASPTKPTTSSPSSSSAVSGSLKSKVDGLRFYSKPSWEDKDVVGTVNKGIGFPTVVE
KVKVGSAYQYKVKNSKGTTYYITASDKYVDVTGSVKTSSSAPKTTSTSSSSSSIKSVGKI
KIVGVSSAAIVMDKPDRNSSKNIGTVKLGSTISISGSVKGKNNSNGYWEVIYKGKRGYIS
GQFGSTI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttcactaatagctacattccagtcaataagtatactagaccaggtttgaaa
ttacagggtgtgaaaaaatgcgtcctacactatacagccaatccgggtgcaggtgcagac
aatcatcgaagatacttcagtaatgcacaagtttatgcatcagctcacattttcgtagat
aaggctgaagcaatttgtatcattccattaaatgaagtagcttaccatgcaaatgatatt
cagcaaagagatagtgccggaaatccttatcgaggagttgctgcgctgaaacctaacgct
aactttctttctattggagttgaaatgtgccttgaaaaagacggttcattccattcagat
acagttgaaagaactgaggatgtgttcgttgaattatgtaataagtttggtttagatcct
attgatgatattgttcgtcattatgacatcacccataagaattgccctgcaccatgggta
tctaacagccaaaaatttgtagactttaaaaatcgagtaaaggcaaaaatgtcaggcaaa
tctgtttcaaaagcttctccaactaaaccaacaacctcctccccttcctcttcatcagca
gtaagtggttcactaaaatcaaaagttgacggacttcgcttctattcaaaaccatcttgg
gaagataaagatgttgtcggcacagtaaataaaggcatcggatttcctacagttgtagag
aaagttaaagttggatctgcctatcaatacaaagttaagaactcaaaaggcactacatat
tacatcactgcttctgacaaatatgttgatgttacaggatcagttaaaacctcttcctct
gccccaaaaacaacatcaacttcttcaagttcctcatctattaaatccgtaggaaaaatc
aaaattgtcggtgtatcaagcgctgcaatcgtaatggacaagcctgatcgaaatagttct
aaaaatattggcacagttaagcttggaagcactatttcaatttctggttcagttaaaggt
aaaaacaattccaatggctactgggaagttatttataaaggtaaacgtggatatatctcg
ggacagtttggatcaacaatctaa

DBGET integrated database retrieval system