KEGG   Bacillus subtilis subsp. subtilis 168: BSU21470
Entry
BSU21470          CDS       T00010                                 

Symbol
sunT
Name
(RefSeq) sublancin-168-processing and transport ATP-binding protein SunT
  KO
K20344  ATP-binding cassette, subfamily C, bacteriocin exporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU21470 (sunT)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU21470 (sunT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU21470 (sunT)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU21470 (sunT)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C39
   BSU21470 (sunT)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BSU21470 (sunT)
SSDB
Motif
Pfam: ABC_membrane Peptidase_C39 ABC_tran Sigma54_activat AAA_24 AAA_22 AAA_29 Sigma54_activ_2 AAA_7 AAA_5 Septin RNA_helicase Guanylate_cyc_2 AAA_18 AAA AAA_16 NACHT AAA_33 RsgA_GTPase SRP54 AAA_25
Other DBs
NCBI-GeneID: 939124
NCBI-ProteinID: NP_390030
Pasteur: BG12683
BSORF: BG12683
UniProt: P68579 A0A6M4JKV9
Position
complement(2267346..2269463)
AA seq 705 aa
MNKKKKYVHTKQFNSHDCGLACISSILKFHNLNYGIDFLLDLIGDKEGYSLRDLIVIFKK
MGIKTRPLELQENKTFEALKQIKLPCIALLEGEEYGHYITIYEIRNNYLLVSDPDKDKIT
KIKKEDFESKFTNFILEIDKESIPEKEKDQKKHSYFFKDILFRNKLIVFVILLTSLFVVG
LAVAGSFYIKFLVDLIIPRSLRESLITITLIFISMVLIRCIFDFVRSYLIIKLSYKVDKE
MSNVYFNKVTKLPINFFENREDGEVISRFNDGIYIKDFFSANFVTAIIDIILILGLGVIL
YRTNNILFLTIILPILLLSCLAILFFDHLKKKNQKLMEDKAKSTSLLINFLKNMTTVYSL
NKTSFFLEKFHLTYDKQLNSTFSVAKAVISNEILKGLIQNSFTIIILWVGTRQVLNDSMS
LGTLLFINTLAAFLLSSLDRILSMQSDLQQAHVASIRFFDVVNYPVQQDSNENLTELDFI
QNIKTVNLNIGADPMRYIVEDINLILDRKDKVLIIGESGTGKSTFAKSLSKLYKVPDKSI
YLNGLDINRYDHLSIRKRIVYIDENPFLFKGTIKENLCMGEIFDQNEIENACIMSQCHEF
ICNLDKQYSYKLSENGSNLSTGQKQRLALARAILHQPQVLILDESLSNIDPDNTKLIYET
LHRMDCLIILITHNDPSNFKYNKKLVFRNNRIIESSYSENKEYSI
NT seq 2118 nt   +upstreamnt  +downstreamnt
ttgaataagaaaaagaaatatgttcatactaaacagtttaatagtcatgattgtggacta
gcttgtatctcgtcaattttaaagtttcataaccttaactatggaattgatttcttacta
gacctaattggggataaggaaggctatagtttaagagacttaattgttatttttaagaag
atggggataaaaactaggccacttgaattgcaagaaaataagacattcgaagccctaaaa
caaataaagctcccttgtatagctttgttagaaggggaggaatatggacattacataaca
atatacgaaattagaaataactatttacttgttagtgatcctgataaagacaaaataact
aaaataaaaaaagaggattttgaaagtaaattcacaaactttatattagaaattgacaaa
gagtcaattcctgaaaaagaaaaagatcaaaaaaaacattcttacttttttaaggacata
ctttttagaaataaattgatcgtttttgtgattttattgacttccttgttcgttgtgggt
cttgctgtagctgggtcgttttatataaagtttctagttgacctaattatcccaagaagc
ttaagagaatctttaatcacaatcactttaatattcataagtatggtcttaataaggtgc
atcttcgattttgtaagatcatatttgataataaaattgtcttacaaagttgataaagag
atgtcaaatgtttattttaataaagtaacaaaattacctattaatttttttgaaaacaga
gaagatggagaggtaatttctcgattcaatgatggtatatatattaaagacttttttagt
gctaactttgttactgcaataattgatataattttaatactgggattaggagttatttta
tatagaacaaataacattcttttcttaacaattattctcccgattttgctactttcatgt
ctagcgattttgttttttgatcatcttaaaaagaaaaatcaaaaactgatggaggataag
gctaaatctacctctcttttaattaattttctgaagaatatgacaactgtttattcttta
aataaaacctcgttttttttagaaaaatttcatcttacatatgataaacaattaaattca
acctttagtgtagcaaaggcagttattagcaatgaaatactaaaaggattaattcaaaac
tcttttacaataattatcctatgggttgggacaagacaagttctaaatgattcaatgagt
ttgggtacactgctatttataaacacattagcagcctttttgctaagttcactagatcgt
atattgagtatgcaatcagatcttcagcaggcacatgttgcttccataagattttttgac
gtagtaaactatccagttcagcaagatagcaatgagaatttaactgaacttgattttatt
cagaatatcaaaacagttaatcttaatattggggcagacccaatgcgttatatagttgaa
gatattaatttaatattagacagaaaggataaagtccttattattggagaaagtggtact
ggaaaaagtacgtttgcaaaaagtttgtctaaattgtataaagtacccgataagtcaatt
tatttaaatggattagatattaatcgatacgatcatttatcaataagaaaaaggattgta
tatattgacgaaaatccttttctttttaagggaaccattaaagagaatctttgcatggga
gagatttttgatcagaacgaaattgaaaacgcgtgtataatgtcccaatgccatgaattc
atttgtaacttggacaagcagtacagttataaattgtctgaaaacggttccaatctatct
acaggacaaaaacaacggttagcattagcaagagcaattttacatcaaccacaagtatta
attttagatgagtcattatctaacattgatccggataacacaaaattgatttatgaaacc
ttacacaggatggattgtttaattattcttataactcataatgacccaagtaacttcaaa
tacaataaaaaattagtattcagaaacaataggattatagagtcgagctactcggaaaat
aaggagtattctatatga

DBGET integrated database retrieval system