KEGG   Bacillus subtilis subsp. subtilis 168: BSU21600Help
Entry
BSU21600          CDS       T00010                                 

Gene name
yokG
Definition
(RefSeq) pesticidal crystal protein-like YokG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dynactin_p22 FAS_N Peptidase_M9_N
Motif
Other DBs
NCBI-GeneID: 939112
NCBI-ProteinID: NP_390043
Pasteur: BG13574
BSORF: BG13574
UniProt: O32000
Position
complement(2278602..2279675)
Genome map
AA seq 357 aa AA seqDB search
MKYDNLLDATSQYGPQDLLLGRDGLISTGYWAKTQANILTGTGLPVSNDEMKTYLNLPKN
VEIPQDFQKLYDVYNEYKKLCDWWLEKLLSCVNKMANDIYNVGSTTSELINEALQPGLRA
ITTASNDQDRQDAIQDFHEVCLILMRELDENQQSMKDVQNLLNSFLQGGNNFIGVTQLNN
SFEEVMTYLDSQYNDESEIHDLLNIFMQFKKLLGESLEEHEINEKVKFSSELGPLIGYIV
SEMLEYSDVQMFKQRIDNFQNLNGVDAQVALVVKVLSLFHGINIDLHNVIYQAERSLEFI
EQTEGNWHSIANQFYSLAQGFENEDINKLSTDLDNAAATWEAVANKAKEFVTNSYQG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgataatcttttagatgcaacatcccaatatggaccacaggatcttttatta
ggaagagatgggctaatatctactggatattgggcaaaaactcaagctaatattcttact
ggaacgggtttgcctgtgagcaatgatgagatgaaaacttatttgaacttaccgaaaaac
gttgaaatacctcaagattttcagaaattatatgatgtttataacgaatataaaaagttg
tgtgactggtggttggagaaattattaagctgtgttaataaaatggctaatgatatatac
aatgttgggtctaccacttcggaattgataaacgaagcattacaaccaggtttaagggca
attacaactgcaagcaatgatcaagatagacaagatgctattcaagattttcatgaggtc
tgtcttatacttatgagagagctcgatgaaaatcaacaatctatgaaagatgttcaaaat
ctactaaattcctttcttcaaggaggtaacaacttcataggtgttacacaattgaacaat
tcttttgaagaagtaatgacttatttagattcacaatacaatgatgagagcgagatacat
gatttattgaatatattcatgcaatttaaaaaattgttgggtgaaagtcttgaagagcat
gagataaatgagaaagtaaaattcagctctgagttaggccctttaatcgggtatatagta
tccgaaatgttagagtattctgatgttcaaatgtttaaacaacgaattgataattttcag
aatttaaacggtgtagatgcacaagttgcattagttgtaaaagttttaagtctgtttcac
ggcatcaatatagacttgcataatgtaatataccaggcagaaaggtctctggagtttata
gaacaaactgaaggaaactggcattctatagcaaatcaattttattcactcgcacaaggg
tttgagaatgaggatatcaataagctttctacggatcttgataatgctgcggccacttgg
gaagctgttgctaataaagcaaaagagtttgtaacaaattcataccaaggataa

DBGET integrated database retrieval system