KEGG   Bacillus subtilis subsp. subtilis 168: BSU21600
Entry
BSU21600          CDS       T00010                                 

Symbol
yokG
Name
(RefSeq) pesticidal crystal protein-like YokG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAS_N Dynactin_p22 Methyltransf_2 ALIX_LYPXL_bnd Peptidase_M9_N
Other DBs
NCBI-GeneID: 939112
NCBI-ProteinID: NP_390043
Pasteur: BG13574
BSORF: BG13574
UniProt: O32000 A0A6M4JNH9
Position
complement(2278602..2279675)
AA seq 357 aa
MKYDNLLDATSQYGPQDLLLGRDGLISTGYWAKTQANILTGTGLPVSNDEMKTYLNLPKN
VEIPQDFQKLYDVYNEYKKLCDWWLEKLLSCVNKMANDIYNVGSTTSELINEALQPGLRA
ITTASNDQDRQDAIQDFHEVCLILMRELDENQQSMKDVQNLLNSFLQGGNNFIGVTQLNN
SFEEVMTYLDSQYNDESEIHDLLNIFMQFKKLLGESLEEHEINEKVKFSSELGPLIGYIV
SEMLEYSDVQMFKQRIDNFQNLNGVDAQVALVVKVLSLFHGINIDLHNVIYQAERSLEFI
EQTEGNWHSIANQFYSLAQGFENEDINKLSTDLDNAAATWEAVANKAKEFVTNSYQG
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaaatatgataatcttttagatgcaacatcccaatatggaccacaggatcttttatta
ggaagagatgggctaatatctactggatattgggcaaaaactcaagctaatattcttact
ggaacgggtttgcctgtgagcaatgatgagatgaaaacttatttgaacttaccgaaaaac
gttgaaatacctcaagattttcagaaattatatgatgtttataacgaatataaaaagttg
tgtgactggtggttggagaaattattaagctgtgttaataaaatggctaatgatatatac
aatgttgggtctaccacttcggaattgataaacgaagcattacaaccaggtttaagggca
attacaactgcaagcaatgatcaagatagacaagatgctattcaagattttcatgaggtc
tgtcttatacttatgagagagctcgatgaaaatcaacaatctatgaaagatgttcaaaat
ctactaaattcctttcttcaaggaggtaacaacttcataggtgttacacaattgaacaat
tcttttgaagaagtaatgacttatttagattcacaatacaatgatgagagcgagatacat
gatttattgaatatattcatgcaatttaaaaaattgttgggtgaaagtcttgaagagcat
gagataaatgagaaagtaaaattcagctctgagttaggccctttaatcgggtatatagta
tccgaaatgttagagtattctgatgttcaaatgtttaaacaacgaattgataattttcag
aatttaaacggtgtagatgcacaagttgcattagttgtaaaagttttaagtctgtttcac
ggcatcaatatagacttgcataatgtaatataccaggcagaaaggtctctggagtttata
gaacaaactgaaggaaactggcattctatagcaaatcaattttattcactcgcacaaggg
tttgagaatgaggatatcaataagctttctacggatcttgataatgctgcggccacttgg
gaagctgttgctaataaagcaaaagagtttgtaacaaattcataccaaggataa

DBGET integrated database retrieval system