KEGG   Bacillus subtilis subsp. subtilis 168: BSU21710Help
Entry
BSU21710          CDS       T00010                                 

Gene name
dinF
Definition
(RefSeq) multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 939104
NCBI-ProteinID: NP_390054
Pasteur: BG11625
BSORF: BG11625
UniProt: P54181
Position
complement(2288669..2290006)
Genome map
AA seq 445 aa AA seqDB search
MKAYDFTQGNVLKQLVLFSMPIMLGNALQVSFQFIDSLWIGNLLGAKALGAAAVSSTIVL
TVLSFILGLNNATLTILSQQKGKDDIKGMASYINAFVVLLTGLSIGFGAAGFFLSELLLR
LLKTPESMIPLAETYLQIQFIGILFLFGYNFISTVLRALGDSKTPLRFIAFAVVLNTVLA
PLFISVFRMGIAGAAYSTILSQGIAFLYGLFYVIKHKLVPFSIPRMPKWEESALILKLGI
PAGLQMMVITGGMMAIMSVVNSYGDHVVSGFGAVQRLDSIITLPAMAAGTAVNSMAGQNI
GIGNEKRVGTIARLGVIAVISCMLVIAVMIWVFGKYLIRLFISEPDAVAFGEQYLKWIAF
FYPFIGVNFVLNGIVRAAGAMLQVLVLNLISFWVLRYPFTALFSAWLGQKGIGLGIGMSF
LFSSCAAFLYYRYGRWKAMKLFTEK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacgattttacacaggggaacgtgctgaaacagcttgtactgttttcaatg
cctattatgctcggaaacgcattgcaggtttcctttcaatttatagacagcttgtggatc
ggcaatttactgggggcaaaggcccttggggcagccgcggtatcaagcacgattgttttg
accgtgctgtcttttattttgggccttaacaatgcgacgttaaccattttatctcagcaa
aaaggaaaagatgatataaaaggaatggcgtcgtatattaacgcttttgttgttttatta
acaggcctaagcatcggattcggcgcggccggtttttttctctcagagcttttgctgcgt
cttctaaaaacgccggagtcaatgataccgcttgctgagacgtatttacagattcaattt
atcggcattttatttttgtttggttataactttatcagtactgtgcttcgtgcgctgggc
gacagcaagacacctctccggtttattgcgtttgctgttgtactgaatacagtgcttgcg
ccgctctttatttctgtgttccgcatgggaatagcgggagcggcttattcaacgattttg
tcacagggcattgcgtttttgtatgggttgttttatgtcatcaaacacaagcttgtgcca
ttctcgattccgagaatgcccaagtgggaagagtccgcgctgattttgaaactcgggatt
ccggcaggtctgcagatgatggtgattacaggcggtatgatggcgattatgagtgttgtt
aactcatacggggatcacgtggtatcaggctttggcgcggtgcagcggcttgatagcatc
atcacgcttccagcaatggctgccggtacggccgtcaatagtatggcagggcaaaatatt
ggaatcggaaacgaaaaaagagtgggaacaattgcaaggctaggtgtgatagctgttatt
tcctgcatgctggtgattgcggttatgatttgggtatttggtaaatacctcataaggtta
tttatcagtgagcctgatgcggtcgcatttggtgaacaatatttgaagtggatcgcgttt
ttctacccttttattggggttaattttgtgctgaacggaatcgtcagggccgcgggagcg
atgctgcaggttctggtattaaatttgatctcgttttgggtgttgaggtatcctttcaca
gctctattttcagcttggcttggacaaaaaggaatcgggcttggaatcggaatgagtttt
ttatttagcagctgcgcggcatttttgtattatagatatggccgctggaaagcaatgaag
ctgtttactgaaaaataa

DBGET integrated database retrieval system