KEGG   Bacillus subtilis subsp. subtilis 168: BSU21780Help
Entry
BSU21780          CDS       T00010                                 

Gene name
yplP
Definition
(RefSeq) sigma L-dependent transcriptional regulator YplP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_12 Bac_DnaA AAA AAA_5 TIP49 AAA_7 IstB_IS21
Motif
Other DBs
NCBI-GeneID: 939094
NCBI-ProteinID: NP_390061
Pasteur: BG11619
BSORF: BG11619
UniProt: P54156
Position
2294286..2295281
Genome map
AA seq 331 aa AA seqDB search
MNSAPKLNTFQHLIGEHQTFLEAKRIAKQFSLSELPVLITGKIGTGKNHFAHAIHLESSR
SNEPFISVNCSTHSEETLIHELFGPNGNTGVFQKAVRGTLFLDDVWRMPASVQAQLLKAL
DSDTEKPRMICASADRSVEHTFRQDLFYRLNILTLTLPELSERKSDIPLLTQHFLSNSGQ
QLLIDPSVFPVLEKHAFEGNVRELKNAADYMAAVSSGGTIQPYDLPPYIRGTIDGKTSKK
KAKLLTLMEKAEFLFILETIKVLNEKGEPASRRIISEHSKNTQTSLTPQQVRSRLDYLEK
KDYVTKSRGRAGTKITFEGLSFIETLKNQMI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgcaccaaaactcaatacatttcaacatctaatcggagaacatcaaactttt
ctggaagcgaagcgaatcgccaagcagttctcgttatcggagcttcctgtcttaataaca
ggaaaaatcggaacaggcaaaaatcacttcgcacatgccatacacttggaatcttcgaga
agcaatgaaccgtttataagcgtcaattgcagcacccattcggaagaaacccttattcat
gagctttttggccctaacggaaacacaggtgtttttcaaaaagcggtacgaggaaccctt
tttcttgatgatgtatggcgcatgcctgcttctgtacaagctcagctgttaaaagcgctt
gattcagacacggagaaaccgcgaatgatctgtgcttctgcagaccgatccgtggaacat
acattcaggcaagacttattctacagactgaacattttaacgctcacactgcccgaatta
tcggaacgaaaaagcgatattccgcttttgacacagcattttctctcaaattctggtcag
caattgttaatcgatccctccgtttttcccgtgcttgagaagcatgcatttgaaggcaat
gtcagggaattaaaaaacgctgcagattatatggcggcagtatcaagcgggggaacgatt
cagccatatgacctgccgccgtatattagaggcacgatagacggaaaaacgtcgaagaaa
aaagcgaaactgcttactttaatggaaaaagctgagtttttgtttattttggaaacaata
aaagtattgaacgaaaaaggagaacctgccagcagacggatcatttctgaacacagcaaa
aatacccaaacctcgttaactcctcagcaggtcagaagccgtctcgactatttggagaaa
aaagattatgtcaccaaaagccgcggacgcgcaggcacaaaaattacctttgagggcttg
agctttatagagacgttaaaaaatcaaatgatctag

DBGET integrated database retrieval system