KEGG   Bacillus subtilis subsp. subtilis 168: BSU22120Help
Entry
BSU22120          CDS       T00010                                 

Gene name
kdgR
Definition
(RefSeq) LacI family transcriptional regulator
  KO
K02525  LacI family transcriptional regulator, kdg operon repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU22120 (kdgR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    BSU22120 (kdgR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_Tnp_ISL3 HTH_17 HTH_26 HTH_19 HTH_31 SpoIIID YdaS_antitoxin HTH_IclR TetR_N HTH_23 HTH_AraC HTH_6 HTH_7 HTH_10 HTH_24 Sigma54_DBD MerR HTH_40 MarR_2
Motif
Other DBs
NCBI-GeneID: 939063
NCBI-ProteinID: NP_390094
Pasteur: BG11398
BSORF: BG11398
UniProt: P50844
Position
complement(2324613..2325632)
Genome map
AA seq 339 aa AA seqDB search
MKKKTTGHTTIKDVAECAGVSKSTVSRYINGKIDAISPEKVKNIKKAIAELNYRPSKMAQ
GLKIKKSKLIGFVVADITNPFSVAAFRGVEEVCDQYGYSIMVCNTDNSPEKEREMLLKLE
AHSVEGLILNATGENKDVLRAFAEQQIPTILIDRKLPDLKLDTVTTDNRWITKEILQKVY
SKGYTDVALFTEPISSISPRAERAAVYQEMASVQNVNGLVRLHEIDVKDKEQLKAELRSF
HKEMPEQKKAILALNGLIMLKIISCMEELGLRIPQDIGIAGFDDTEWYKLIGPGITTIAQ
PSHDMGRTAMERVLKRIEGDKGAPQTIELEAKVIMRKSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacaacaggccatacaaccatcaaagacgtagctgaatgtgcaggagtt
tcgaaatcgacagtttcccgctatattaacggaaaaattgacgcgatttctcctgaaaaa
gtgaaaaacattaaaaaggcaatcgcagaattgaattatcggccgagtaaaatggcacaa
ggtttgaaaataaaaaaaagcaagttaatcggatttgttgtggctgacattacaaatcct
ttttcggtcgctgctttcaggggagtcgaagaggtttgtgatcaatatggatacagcatt
atggtgtgcaacacagataacagtcctgaaaaagagcgggaaatgctcttaaagctagaa
gcccattcggttgagggcttgattttaaacgcaacaggggaaaacaaggatgtactccgc
gcttttgctgaacagcaaattccaacaatcttaattgaccggaaactgccggatctgaaa
ctggataccgtaacgactgacaacagatggatcacaaaagagattcttcagaaggtgtac
agcaaagggtatactgatgtcgcgctgtttaccgaaccgatttcctctatcagccctcgt
gcagaaagagcagctgtgtatcaggaaatggcttcggttcaaaatgtgaacgggcttgtc
agattgcatgaaattgacgtaaaggacaaggagcagcttaaggcggagcttcgttctttt
cacaaggaaatgccggagcaaaaaaaagcgattctggctttgaatggcttgattatgctg
aaaatcatcagctgtatggaagagcttggcctgcgcatccctcaagatatagggattgca
ggattcgatgatacggagtggtacaaactgatcggtccaggcattacaacgatcgcccag
ccgtcacatgatatgggcaggacggcgatggaacgtgtattaaaaaggattgaaggtgac
aaaggagcgcctcaaaccattgaattagaggcaaaagtcatcatgagaaagtcactttaa

DBGET integrated database retrieval system