KEGG   Bacillus subtilis subsp. subtilis 168: BSU22150Help
Entry
BSU22150          CDS       T00010                                 

Gene name
ypvA
Definition
(RefSeq) ATP-dependent helicase YpvA
  KO
K03722  ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU22150 (ypvA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU22150 (ypvA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    BSU22150 (ypvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C_2 DEAD ResIII ATPase
Motif
Other DBs
NCBI-GeneID: 939060
NCBI-ProteinID: NP_390097
Pasteur: BG11457
BSORF: BG11457
UniProt: P50831
Position
complement(2327488..2329413)
Genome map
AA seq 641 aa AA seqDB search
MTTSRLPFSLTKTKNFYEELNNWIGDVFYDILPEKGFDLRDEQVFMAFQLERAFKEKKVM
FAEAGVGTGKTLVYLLFAISYARYVGKPAIIACADETLIEQLVKKEGDISKLAEHLDLKI
DTRLSKSHEQYLCLKKLEKTMQRSDDDKWLDLYESLPSFVHESQAMQRFYPYGDRKQYAN
LSNEEWSDVSYDSFQDCLTCDMRHRCGLTLSRDYYRKSTDLIICSHDFYMEHVWTEESRK
REGQLPLLPDHSAVVFDEGHLLEFAAQKALTYRVKQSTLELFLERLLQNDIREEFAELIE
DALLANDEFFYVLSEESKEVAGSHRLEIKNDHRVKKAADELCRLLDKIGEALVFESEMYT
IDQYELSVVEEYVEQMAYSLSLYQKDAISWLEKKEAESTFVVMPRTVAEVLGEKVFSKKI
PYIFSSATLSEGGSFDYIADSLGIHDYLSLTVDSPYDYDEQMSINLYAKTDMDAEQKTAE
TIETIKRYKGRTLVLFPSFEELNEFKELSAAWELPYPIFFEGDEEISSLVEKFQEEEETV
LCSVHLWEGLDIPGDALKNVTIWSLPFPPHDPVFTAKRNGAKKDPFEEVDLPYMLLRVRQ
GIGRLIRSNQDSGSIHIYAGGENERIIDEVKKVLPVEPHMM
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacatcacgtttgcctttttctttaacgaaaacaaagaatttttatgaagaattg
aacaattggattggtgacgtgttttacgatatccttcccgaaaaagggtttgatcttcgg
gacgagcaagtatttatggcttttcagctggagcgggcgtttaaagagaaaaaagtcatg
ttcgccgaagctggagtgggaacggggaaaacgctggtatatcttctttttgcaatcagc
tatgcaaggtatgtcggcaaacctgccatcatcgcttgtgcggatgaaacattaattgaa
cagctggtgaaaaaagagggcgatatttctaagctggctgagcatcttgatctgaaaatt
gatacaaggctgtcaaaatcacatgagcaatatttatgcttgaagaagcttgaaaaaaca
atgcagcgttctgatgatgataaatggctggatctttatgagtcgttaccgtcatttgtc
cacgagtcccaggcgatgcagcgcttttatccgtatggcgaccgtaagcagtacgcaaat
ctatcgaatgaagagtggtctgacgtaagctacgactcgtttcaggactgtctgacttgt
gatatgagacacagatgcggtctgacactttccagagattactaccgcaagtcaacggac
ttaatcatttgttcccatgatttttatatggagcatgtgtggacggaagaatcacgcaaa
cgagagggccagctgccgctcttgcctgatcatagtgcagttgtatttgatgaggggcac
ttgttagagtttgctgcgcaaaaagcgctaacctatagagtgaagcagtctactcttgaa
ttgtttttagaacgattgctgcaaaatgacatcagagaagagtttgcagaattgattgaa
gatgcgcttctcgcaaacgacgaatttttctatgttctttctgaagaatcaaaggaagta
gccggttcacaccgtttagaaataaaaaatgaccatcgtgtcaaaaaggcggcggacgag
ctttgccgtttacttgataaaatcggtgaggcacttgtatttgagtctgaaatgtatacg
attgatcaatacgaactgtcagtagtggaagaatatgttgaacaaatggcgtattcatta
tctctatatcaaaaggatgcgatcagctggctggagaaaaaggaagcagaatcaaccttt
gtcgtgatgccgagaacggtagcagaagtacttggcgaaaaagtgttttctaagaaaatt
ccttatatcttttcttctgctacgctgtcagaaggcggttcgtttgattatattgccgac
agtcttgggattcatgattatttgtcattaactgttgattccccttatgattatgacgag
caaatgagtattaatctatacgcaaaaacagatatggacgctgaacaaaaaacggctgaa
acgattgaaacaatcaaacgatacaaaggaagaacgctggtgcttttcccttcttttgaa
gaattaaacgagtttaaagagctgtcggcggcatgggagctgccgtatccaattttcttc
gaaggtgatgaggaaatcagcagcttagtagagaaattccaagaggaagaagaaacagta
ctttgttcagttcacttatgggaaggactcgacattcccggtgacgcattgaagaatgtt
accatttggtcattaccgttcccgccacacgatcctgtatttacagcgaagcgcaacgga
gcgaaaaaagatccgttcgaagaagttgatctgccatatatgttgttacgtgtacggcag
ggcatcgggcgcctgattcgctcgaatcaagacagcggctcgattcacatttacgctggc
ggagaaaatgaacgcatcattgatgaggtcaaaaaggtcttgcctgttgaaccgcacatg
atgtaa

DBGET integrated database retrieval system