KEGG   Bacillus subtilis subsp. subtilis 168: BSU22280
Entry
BSU22280          CDS       T00010                                 

Gene name
yppD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5446 Jnk-SapK_ap_N Allexi_40kDa Baculo_PEP_C DUF3136
Other DBs
NCBI-GeneID: 939042
NCBI-ProteinID: NP_390110
Pasteur: BG11445
BSORF: BG11445
UniProt: P50832 A0A6M4JIJ0
Position
complement(2339226..2339471)
AA seq 81 aa
MSGYVCKTDILRMLSDIEDELTRAEQSLNHSVNALEAEMRETENDRLSVLEEEIIDLHIC
INELYQSPEHRYAFEKVYRIG
NT seq 246 nt   +upstreamnt  +downstreamnt
atgtccggttatgtatgcaagacagatattctccgtatgctttctgatatagaagatgaa
ttaacgcgagctgagcaaagcctgaatcattctgtaaatgcattagaggctgagatgcgg
gaaacggagaacgatcgcctaagtgtgctcgaagaagaaatcatagatcttcatatttgt
ataaatgagctgtatcaatcgcctgaacacaggtatgcgtttgagaaggtataccgcatc
ggctga

DBGET integrated database retrieval system