KEGG   Bacillus subtilis subsp. subtilis 168: BSU22340Help
Entry
BSU22340          CDS       T00010                                 

Gene name
nth
Definition
(RefSeq) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU22340 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU22340 (nth)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     BSU22340 (nth)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BSU22340 (nth)
 Prokaryotic Type
     BSU22340 (nth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S MutS_II HHH_5 HHH_8
Motif
Other DBs
NCBI-GeneID: 939036
NCBI-ProteinID: NP_390115
Pasteur: BG10956
BSORF: BG10956
UniProt: P39788
Position
complement(2344755..2345414)
Genome map
AA seq 219 aa AA seqDB search
MLNLKQIEFCLDKIGDMFPHAECELVHSNPFELVVAVALSAQCTDALVNRVTKTLFQKYK
RPEDYLAVPLEELQQDIKSIGLYRNKAKNIQKLSKMIIEDYGGEVPRDRDELVKLPGVGR
KTANVVVSVAFGVPAIAVDTHVERVSKRLGICRWKDSVLEVEKTLMRKVPKEDWSVTHHR
LIFFGRYHCKAQSPRCAECPLLSLCREGQKRDKKGLVKR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaatctaaaacaaattgaattctgtttagacaagataggtgacatgtttcctcat
gcggagtgtgaactggttcattccaatccttttgaattagtggtggctgttgctttatct
gcgcaatgtacagatgcacttgtaaacagagtgaccaaaacattattccaaaaatataaa
cggccggaagactatttggctgttccgctggaagagcttcagcaggatattaaatcaatc
ggtttatatcgtaataaagcgaaaaatattcaaaagctgagtaaaatgattattgaagat
tacggcggagaagtgccgagagaccgcgatgagcttgtcaaactgccaggggtcgggaga
aagaccgcaaacgtagtggtatccgttgcgtttggcgtgccggccatagccgtagatacc
catgtggagagagtcagcaaacgattgggcatttgccggtggaaggactcggttctggaa
gttgaaaagacgctgatgcgcaaggttcccaaagaagattggtccgttacgcatcaccgg
cttattttcttcggcagatatcactgtaaagcccaatctccgcgctgtgcggagtgtccg
ctgctttctttgtgcagagaagggcagaagagggataaaaaaggactggtgaaacgatga

DBGET integrated database retrieval system