KEGG   Bacillus subtilis subsp. subtilis 168: BSU22740
Entry
BSU22740          CDS       T00010                                 

Symbol
hepT
Name
(RefSeq) heptaprenyl diphosphate synthase component 2
  KO
K24873  heptaprenyl diphosphate synthase component 2 [EC:2.5.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU22740 (hepT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU22740 (hepT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.30  heptaprenyl diphosphate synthase
     BSU22740 (hepT)
Prenyltransferases [BR:bsu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BSU22740 (hepT)
SSDB
Motif
Pfam: polyprenyl_synt POTRA_TamA_1
Other DBs
NCBI-GeneID: 939002
NCBI-ProteinID: NP_390155
Pasteur: BG10281
BSORF: BG10281
UniProt: P31114 A3F3D7
Position
complement(2381919..2382965)
AA seq 348 aa
MLNIIRLLAESLPRISDGNENTDVWVNDMKFKMAYSFLNDDIDVIERELEQTVRSDYPLL
SEAGLHLLQAGGKRIRPVFVLLSGMFGDYDINKIKYVAVTLEMIHMASLVHDDVIDDAEL
RRGKPTIKAKWDNRIAMYTGDYMLAGSLEMMTRINEPKAHRILSQTIVEVCLGEIEQIKD
KYNMEQNLRTYLRRIKRKTALLIAVSCQLGAIASGADEKIHKALYWFGYYVGMSYQIIDD
ILDFTSTEEELGKPVGGDLLQGNVTLPVLYALKNPALKNQLKLINSETTQEQLEPIIEEI
KKTDAIEASMAVSEMYLQKAFQKLNTLPRGRARSSLAAIAKYIGKRKF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgttaaatatcattcgtttactggcggagtcgctgccacgcatatcggatggaaatgaa
aacacagatgtttgggtgaatgatatgaaatttaaaatggcctactcttttttaaatgac
gatattgatgtaatcgaaagagaacttgaacaaaccgtacgttccgattacccgctttta
agcgaggcaggtcttcacctgctgcaggccggagggaaacgtattcggcctgttttcgtg
ctgctttctggcatgtttggcgattatgatattaataagattaaatatgtcgccgtcact
ctggaaatgattcacatggcatctttggttcatgatgatgtcattgatgatgcagagctt
cgccgaggaaaaccgacaatcaaagcaaagtgggacaatcgtattgcgatgtacacaggc
gattatatgcttgcgggatctcttgaaatgatgacgagaattaacgaaccgaaagcccat
aggattttgtcacagacgatcgttgaagtttgtctaggggaaattgagcagatcaaagac
aaatacaacatggaacaaaatctcagaacgtatctccgccgtatcaaaagaaaaacagct
ctcttgatcgcggtcagctgccagcttggtgccattgcgtctggagctgatgagaagatt
cataaggcattgtactggtttgggtattacgtcggcatgtcttatcagattattgatgat
attcttgattttacttcaactgaggaagagctgggtaaacccgtaggaggagatttgctt
caaggaaacgtcacattgccagtgctgtatgccctgaaaaatcctgcattaaaaaaccag
cttaaattgattaacagtgagacaacgcaggaacagcttgaaccaatcattgaagaaatc
aaaaaaacagatgcaattgaagcatctatggcagtaagcgaaatgtatctgcagaaagct
tttcagaaattaaacacgcttcctcgagggcgcgcacgctcgtctcttgcagccatcgca
aaatatatcggtaaaagaaaattttaa

DBGET integrated database retrieval system