KEGG   Bacillus subtilis subsp. subtilis 168: BSU22930
Entry
BSU22930          CDS       T00010                                 

Gene name
sleB
Definition
(RefSeq) spore cortex-lytic enzyme
  KO
K01449  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU22930 (sleB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU22930 (sleB)
SSDB
Motif
Pfam: Hydrolase_2 PG_binding_1
Other DBs
NCBI-GeneID: 938979
NCBI-ProteinID: NP_390174
Pasteur: BG11439
BSORF: BG11439
UniProt: P50739 A0A6M4JLD2
Position
complement(2399152..2400069)
AA seq 305 aa
MKSKGSIMACLILFSFTITTFINTETISAFSNQVIQRGATGDDVVELQARLQYNGYYNGK
IDGVYGWGTYWAVRNFQDQFGLKEVDGLVGAKTKQTLICKSKYYREYVMEQLNKGNTFTH
YGKIPLKYQTKPSKAATQKARQQAEARQKQPAEKTTQKPKANANKQQNNTPAKARKQDAV
AANMPGGFSNNDIRLLAQAVYGEARGEPYEGQVAIAAVILNRLNSPLFPNSVAGVIFEPL
AFTAVADGQIYMQPNETAREAVLDAINGWDPSEEALYYFNPDTATSPWIWGRPQIKRIGK
HIFCE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagtccaaaggatcgattatggcatgtctcatccttttttcctttacaataacgacg
tttattaatactgaaacgatctctgccttttcgaatcaggtcattcaaagaggggcaaca
ggggatgatgtggtcgagcttcaggcgcgtcttcaatacaacggatattataacggaaaa
attgacggggtttatggatgggggacgtactgggcagttcgaaattttcaggatcaattc
gggttaaaagaggttgacggccttgtaggagctaaaacaaagcaaaccttaatatgtaaa
tcaaaatactatcgtgaatatgtcatggaacagctcaataaagggaatacattcacgcat
tacggaaaaattccgctaaagtatcagacgaaaccatcaaaagcagcaacacaaaaggca
agacaacaagcagaagcacggcagaaacagcctgcggaaaaaacaacgcagaagcctaaa
gcgaatgcgaataaacagcaaaacaatacaccagcaaaagcaagaaaacaggatgcggta
gcagcgaacatgcctggtggattttccaacaacgatatcaggctgcttgctcaagcggtt
tatggcgaagcccggggcgagccgtacgaggggcaggttgctattgcagcagtcatttta
aaccgtttgaacagcccgttatttccaaattcagtagcgggggttatttttgagccgctt
gccttcacagcagtagccgacggacaaatttacatgcagccgaatgaaacggcacgagaa
gcagtgctggatgccatcaatggctgggacccatcagaggaagcactttactactttaat
ccggatacggctacaagtccgtggatttgggggcgtccgcagattaaaagaatcggtaaa
cacattttctgtgagtag

DBGET integrated database retrieval system