KEGG   Bacillus subtilis subsp. subtilis 168: BSU23020
Entry
BSU23020          CDS       T00010                                 

Symbol
recQ
Name
(RefSeq) ATP-dependent DNA helicase RecS
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU23020 (recQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU23020 (recQ)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU23020 (recQ)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU23020 (recQ)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU23020 (recQ)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU23020 (recQ)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII RecQ_Zn_bind SNF2-rel_dom DUF6119
Other DBs
NCBI-GeneID: 938969
NCBI-ProteinID: NP_390183
Pasteur: BG11407
BSORF: BG11407
UniProt: P50729 A0A6M3ZDE4
Position
complement(2406922..2408412)
AA seq 496 aa
MTKLQQTLYQFFGFTSFKKGQQDIIESILSGKDTIAMLPTGGGKSLCYQLPGYMLDGMVL
IVSPLLSLMEDQVQQLKARGEKRAAALNSMLNRQERQFVLEHIHRYKFLYLSPEALQSPY
VLEKLKSVPISLFVIDEAHCISEWGHDFRPDYSKLGQLRKKLGHPPVLALTATATKETLQ
DVMNLLELQHAVRHLNSVNRPNIALRVENAADTAEKIDRVIQLVENLQGPGIVYCPTRKW
AKELAGEIKSKTSSRADFYHGGLESGDRILIQQQFIHNQLDVICCTNAFGMGVDKPDIRY
VIHFHLPQTAEAFMQEIGRAGRDGKPSVSILLRAPGDFELQEQIIQMESVTAEEIADVIR
VLEKTEERDERRLRDVLLQYGVGETQARMMIHLFMQGKTSVELMKKEISYRMELKLEKMH
RVSFLLQRDGCLRQALLTYFDESYEPDDGNLPCCSHCGFDLSLYEQKGERSKMAPLDSWS
SELHRIFSLQTVGELN
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgactaaattacagcaaacgttatatcagttttttggttttacttcctttaaaaaaggg
cagcaggacattattgaaagcatactcagcgggaaggataccattgcaatgctcccgact
gggggagggaaatcgctttgctaccagctgcctggttatatgcttgatggcatggtatta
atcgtttctccactgctttctttaatggaggatcaggtgcagcagctcaaagcccggggg
gaaaagcgtgctgcagctttgaacagcatgcttaacaggcaggaaagacaatttgtttta
gaacatattcatcgatataaatttttgtacttgtctcctgaagctttacagtctccatat
gtattggaaaaattgaaaagcgttccgattagcctatttgttattgacgaagcgcattgt
atttctgaatggggacacgacttcaggcctgattattcaaagctcggacagctgagaaaa
aaacttggacacccacccgttctggcattgaccgccacggctacaaaggaaacgctgcaa
gatgtcatgaacctgctggagctgcagcatgctgtacgccatctcaactcagtcaaccgc
ccaaacatcgcactgagggttgaaaatgcggcggatactgccgaaaaaatagatagggtc
attcagctggttgaaaacctgcaaggtccgggaattgtttattgtccaacacggaaatgg
gctaaggaattagcgggtgaaattaaaagcaaaacgagcagcagagccgacttttaccat
ggcggtttggagtcaggggacaggattttaattcagcagcagtttattcataaccagctt
gatgtgatatgttgtacgaatgcgtttggaatgggtgtcgataaacctgatatcagatat
gtgattcattttcatctcccgcagacggcagaagcttttatgcaggaaatcggcagagcg
ggacgcgacggaaagccgagtgtcagcattttgctgcgggcgccaggggattttgaattg
caggaacaaattatccagatggagagtgtcacagctgaagaaatcgccgacgtaatccgt
gtgctagagaagacggaggagcgggatgagagaaggctgcgtgacgtattacttcagtat
ggcgtcggagagacacaggcccgtatgatgattcatctctttatgcagggaaaaacatca
gttgaactgatgaagaaagaaatttcatatcgcatggagctgaagctggaaaaaatgcac
cgtgtatcatttttgcttcagcgtgacggctgtttaaggcaggcactgttaacctacttt
gatgaatcatacgagcctgatgacggaaacctcccgtgctgttcacattgcggttttgat
ttatccttgtatgaacaaaaaggggaacggagtaaaatggcgccattagacagctggagt
tcggaattgcaccggatattcagcttgcagactgtaggtgagctgaactga

DBGET integrated database retrieval system