KEGG   Bacillus subtilis subsp. subtilis 168: BSU23070
Entry
BSU23070          CDS       T00010                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSU23070 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU23070 (serA)
   00270 Cysteine and methionine metabolism
    BSU23070 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU23070 (serA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BSU23070 (serA)
    1.1.1.399  2-oxoglutarate reductase
     BSU23070 (serA)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU23070 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter ACT NAD_binding_2 IlvN NAD_binding_7 AdoHcyase_NAD 3HCDH_N ACT_4 UDPG_MGDP_dh_C F420_oxidored
Other DBs
NCBI-GeneID: 938964
NCBI-ProteinID: NP_390188
Pasteur: BG10509
BSORF: BG10509
UniProt: P35136 A0A6M3ZIQ1
Position
2411086..2412663
AA seq 525 aa
MFRVLVSDKMSNDGLQPLIESDFIEIVQKNVADAEDELHTFDALLVRSATKVTEDLFNKM
TSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANIS
VKSREWNRTAYVGSELYGKTLGIVGLGRIGSEIAQRARAFGMTVHVFDPFLTEERAKKIG
VNSRTFEEVLESADIITVHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLE
ALENGHVAGAALDVFEVEPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFA
KGLPVMSAINLPAMTKDEFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLET
SFITKALLSGFLKPRVDSTVNEVNAGGVAKERGISFSEKISSSESGYDNCISVKVTGDRS
TFTVTATYIPHFGERIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIAT
MQVGRKEKGGEAIMMLSFDRHLEDKIVKELTNVPDIVSVKLIDLP
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtttcgagtattggtctcagacaaaatgagcaacgacggtttacagccacttattgaa
tcagactttattgaaatcgttcaaaaaaacgtagcagatgcagaagatgaattacatact
tttgatgctcttttggtgcgaagcgcgacaaaagtaacagaagaccttttcaacaaaatg
acttctttaaaaattgtcggaagagccggtgtcggtgtcgataatatcgatattgatgag
gctacgaaacacggggtaatcgtgatcaatgctccgaacggcaacaccatttcgacagct
gagcatacatttgcaatgatctcttctttaatgagacacattccgcaggctaatatctca
gtgaaatccagagagtggaaccgcacagcttatgtcggttcagagctttatggaaaaacg
cttggtattgtaggattaggccgaatcggaagtgaaattgcacagcgtgcgagagcgttc
ggtatgactgtgcacgtttttgatcctttcttaacggaagaaagagcgaaaaaaatcggc
gtaaacagccgtacatttgaagaagtgcttgaaagtgcggatatcattaccgttcacacg
cctttaacaaaagaaacaaaaggcttattgaataaagaaacgattgcaaaaacgaaaaaa
ggcgttcgcttaattaactgtgcgcgaggcggaattatcgatgaagcagcacttctcgaa
gctttggaaaacgggcatgttgcgggagcagcgcttgacgttttcgaagtcgaaccgcca
gttgacaacaaacttgttgatcatccattagtcattgccactcctcacttgggagcatca
acgaaagaagcacagctcaatgtcgccgcccaagtgtcagaagaagttctgcagttcgca
aaaggcctgcctgtcatgtcagctatcaacctgcctgccatgacaaaagatgaatttgct
aaaattaagccttaccatcaaattgcaggaaaaattggcagccttgtatcacagtgcatg
aaagaaccagtacaggatgttgccattcaatatgaaggcacaattgctaaacttgaaaca
tcgttcattacaaaagcccttctgtcaggctttttaaaaccgcgcgtagactctactgtt
aatgaggtcaatgccgggggtgtcgcaaaagaacgcggcattagcttcagtgaaaaaatt
tcctcttctgaatctggatacgataactgcatcagcgtaaaagtgacaggagaccgcagc
acctttactgtaacggctacgtatattcctcatttcggagaacgaattgtcgagatcaat
ggatttaatattgatttttatccgactggtcacttggtgtatatccagcatcaagataca
acaggtgtcatcggccgagtaggacgtattctcggagataatgatattaacattgcaact
atgcaggttggccgtaaggaaaaaggcggagaagccatcatgatgctttcctttgacaga
catctggaagataaaattgtgaaagaactaacaaatgtccctgatattgtgtctgtgaag
ctcattgatctgccataa

DBGET integrated database retrieval system