KEGG   Bacillus subtilis subsp. subtilis 168: BSU23240
Entry
BSU23240          CDS       T00010                                 

Symbol
ypzK
Name
(RefSeq) riboflavin biosynthesis protein RibT
  KO
K02859  riboflavin biosynthesis RibT protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    BSU23240 (ypzK)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_CG PanZ Acetyltransf_13 Acetyltransf_3 DUF4566 Acetyltransf_4
Other DBs
NCBI-GeneID: 938948
NCBI-ProteinID: NP_390205
Pasteur: BG10522
BSORF: BG10522
UniProt: P17622 A0A6M4JKK0
Structure
Position
complement(2427405..2427779)
AA seq 124 aa
MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLFLWKEDEDIVGAIGVE
KKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDI
SYNN
NT seq 375 nt   +upstreamnt  +downstreamnt
atgttaattcgttataaaaaatcgtttgaaaagattgcgatggggcttctttcgtttatg
ccgaatgaaaaagaccttaagcagcttcagcagacaattaaggactacgaaacggataca
gaccgccagctctttctttggaaagaggacgaggatatcgtcggagcaatcggagtcgaa
aaaaaggattctgaggttgagatccggcatatcagtgtgaatccttctcatcgccatcaa
ggaatcggaaaacagatgatggatgctttaaagcatttattcaaaacgcaagtactggtt
ccaaatgaattaacgcagagctttttcgaacgttgtcaaggtcagcaggatcaagacatt
tcatacaataattaa

DBGET integrated database retrieval system