KEGG   Bacillus subtilis subsp. subtilis 168: BSU23240Help
Entry
BSU23240          CDS       T00010                                 

Gene name
ypzK
Definition
(RefSeq) riboflavin biosynthesis protein RibT
  KO
K02859  riboflavin biosynthesis RibT protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    BSU23240 (ypzK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_CG PanZ Acetyltransf_4 Acetyltransf_13 Acetyltransf_3 DUF4566 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 938948
NCBI-ProteinID: NP_390205
Pasteur: BG10522
BSORF: BG10522
UniProt: P17622
Structure
PDB: 

Position
complement(2427405..2427779)
Genome map
AA seq 124 aa AA seqDB search
MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLFLWKEDEDIVGAIGVE
KKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDI
SYNN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgttaattcgttataaaaaatcgtttgaaaagattgcgatggggcttctttcgtttatg
ccgaatgaaaaagaccttaagcagcttcagcagacaattaaggactacgaaacggataca
gaccgccagctctttctttggaaagaggacgaggatatcgtcggagcaatcggagtcgaa
aaaaaggattctgaggttgagatccggcatatcagtgtgaatccttctcatcgccatcaa
ggaatcggaaaacagatgatggatgctttaaagcatttattcaaaacgcaagtactggtt
ccaaatgaattaacgcagagctttttcgaacgttgtcaaggtcagcaggatcaagacatt
tcatacaataattaa

DBGET integrated database retrieval system