KEGG   Bacillus subtilis subsp. subtilis 168: BSU23260
Entry
BSU23260          CDS       T00010                                 

Gene name
ribA
Definition
(RefSeq) riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU23260 (ribA)
   00790 Folate biosynthesis
    BSU23260 (ribA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BSU23260 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BSU23260 (ribA)
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-GeneID: 938946
NCBI-ProteinID: NP_390207
Pasteur: BG10520
BSORF: BG10520
UniProt: P17620 A0A6M4JKZ5
Position
complement(2428389..2429585)
AA seq 398 aa
MFHPIEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLS
EEIADRLDLHPMVEHNTDSHHTAFTVSIDHRETKTGISAQERSFTVQALLDSKSVPSDFQ
RPGHIFPLIAKKGGVLKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIA
KKHQLKMITIKDLIQYRYNLTTLVEREVDITLPTDFGTFKVYGYTNEVDGKEHVAFVMGD
VPFGEEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALNQIAAEGRGVLLYLRQEGRGIGL
INKLKAYKLQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVRNMKLLTNNPRKIAGL
EGYGLSISERVPLQMEAKEHNKKYLQTKMNKLGHLLHF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtttcatccgatagaagaagcactggacgctttaaaaaaaggcgaagtcatcatcgtt
gtagatgatgaagacagagaaaatgaaggagactttgtggctcttgccgagcatgcaacg
ccggaagtcattaactttatggcgacacatgggagaggactgatctgcacgccgctcagt
gaggaaatcgcagacaggcttgatcttcaccctatggttgagcataatacagactctcac
cacactgcatttaccgtaagcatagaccatcgtgaaacgaagacaggtatcagcgctcaa
gaaagatcttttaccgttcaagcattgctggacagcaaatccgtgccatctgattttcag
cgtccggggcacatttttccactgattgcgaaaaaaggaggtgtcctgaaaagagcgggc
catacagaagctgctgttgatcttgctgaagcttgcggatctccaggagccggcgtcatt
tgtgaaattatgaatgaagacggaacgatggcgagagtgcctgagctcattgaaattgcg
aaaaagcatcaattaaaaatgatcaccattaaggatttgattcaataccgttacaatctg
acaacacttgtcgagcgtgaagttgacattacgctgcctactgattttgggacatttaag
gtttatggatacacaaatgaggtagatggaaaagagcatgtcgcatttgtgatgggagat
gtgccgttcggagaagaaccggtattggtccgggtgcattcagaatgtctcacaggtgac
gtgtttggctctcatcgctgtgattgcggaccgcagctgcacgccgcgctgaaccaaatt
gccgcagaaggccgtggagtgctcctgtacttgcgccaagaaggacgaggcatcggttta
atcaataaattaaaagcttataagcttcaggaacaaggctatgacaccgtagaagccaat
gaggcgcttggattcttgccggatcttcgcaactatggcatcggagcacaaattttacgc
gacctcggtgtccggaatatgaagcttttgacgaataatccgcgaaaaatcgcaggcctt
gaaggctacggactcagtatttcagaaagagtgccgcttcaaatggaggcgaaagaacac
aataaaaaatatttgcaaaccaaaatgaacaagctaggtcatttacttcatttctaa

DBGET integrated database retrieval system