KEGG   Bacillus subtilis subsp. subtilis 168: BSU23450
Entry
BSU23450          CDS       T00010                                 

Symbol
sigF
Name
(RefSeq) RNA polymerase sigma-F factor
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU23450 (sigF)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU23450 (sigF)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r3 Sigma70_r4 Sigma70_r4_2 HTH_3 Sigma70_ECF HTH_23 MarR_2 HTH_37 HTH_31 KORA HTH_Crp_2 Trp_repressor GerE DUF3881 HTH_26 DUF134 HTH_50 HTH_28 HTH_24
Other DBs
NCBI-GeneID: 938729
NCBI-ProteinID: NP_390226
Pasteur: BG10298
BSORF: BG10298
UniProt: P07860 A0A6M3ZDB4
Position
complement(2443429..2444196)
AA seq 255 aa
MDVEVKKNGKNAQLKDHEVKELIKQSQNGDQQARDLLIEKNMRLVWSVVQRFLNRGYEPD
DLFQIGCIGLLKSVDKFDLTYDVRFSTYAVPMIIGEIQRFIRDDGTVKVSRSLKELGNKI
RRAKDELSKTLGRVPTVQEIADHLEIEAEDVVLAQEAVRAPSSIHETVYENDGDPITLLD
QIADNSEEKWFDKIALKEAISDLEEREKLIVYLRYYKDQTQSEVAERLGISQVQVSRLEK
KILKQIKVQMDHTDG
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgtggaggttaagaaaaacggcaaaaacgctcagctgaaggatcatgaagtaaag
gaattaatcaaacaaagccaaaatggcgaccagcaggcaagagacctcctcatagaaaaa
aacatgcgtcttgtttggtctgtcgtacagcggtttttaaacagaggatatgagcctgac
gatctcttccagatcggctgcatcgggctgttaaaatctgttgacaaatttgatttaacc
tatgatgtgcgtttttcaacgtatgcagtgccgatgattatcggagaaatccaacgattt
atccgtgatgacggaaccgtaaaggtatcacggtcattaaaagagcttggaaacaaaatc
cggcgcgcgaaggatgagctttcgaaaacactgggcagagtgccgacggtgcaggagatc
gctgaccatttggagattgaagctgaggatgttgtactggcccaagaggcggtaagggct
ccatcttcgattcacgaaaccgtttatgaaaatgacggagatccgattaccctgcttgat
caaatcgctgacaactcagaagaaaaatggtttgacaaaattgcgctgaaagaagcgatc
agcgatttggaggaaagggaaaaactaatcgtctatctcagatattataaagaccagaca
cagtccgaggtggctgagcggctcgggatctctcaggtgcaggtttccaggcttgaaaag
aaaatattaaaacagatcaaggttcaaatggatcatacggatggctag

DBGET integrated database retrieval system