KEGG   Bacillus subtilis subsp. subtilis 168: BSU23590
Entry
BSU23590          CDS       T00010                                 

Symbol
ansR
Name
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 MqsA_antitoxin Phage_CI_repr
Other DBs
NCBI-GeneID: 938717
NCBI-ProteinID: NP_390240
Pasteur: BG10299
BSORF: BG10299
UniProt: Q07683 A0A6M3ZIT6
Position
2456990..2457340
AA seq 116 aa
MNLDRLTELRKKKNWSLQYTADLLGIAKSTYAGYESGYRRPSLEALAMLADLFDTTCDEL
LGREKQKQTAPQAIELATWSSLDFTISVDGQPLSEDEIIQLITFIRTKRKVQEELS
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaatctagatcgtttaactgaattgagaaaaaagaaaaattggtcgcttcaatataca
gctgaccttctcggtatcgcaaaaagcacatatgccggctacgagtcaggctaccgacgg
ccttcacttgaagcgcttgccatgctggctgacctctttgacacaacctgcgatgaactt
ttaggccgcgagaaacaaaagcagactgctcctcaggccatagaattggccacgtggagc
agcctcgactttaccatttctgttgatggccagccgctgagtgaagatgaaatcatccag
ctgattacctttatacgcacaaaaagaaaagtacaggaggaactgagttaa

DBGET integrated database retrieval system