KEGG   Bacillus subtilis subsp. subtilis 168: BSU23640
Entry
BSU23640          CDS       T00010                                 

Symbol
yqkD
Name
(RefSeq) hypothetical protein
  KO
K06889  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU23640 (yqkD)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S15 Peptidase_S9 PhoPQ_related BD-FAE Abhydrolase_6 DUF3951 ABHD18 DLH Abhydrolase_4 DUF829
Other DBs
NCBI-GeneID: 938716
NCBI-ProteinID: NP_390245
Pasteur: BG11759
BSORF: BG11759
UniProt: P54567 A0A6M4JLI7
Position
2460664..2461581
AA seq 305 aa
MKKILLAIGALVTAVIAIGIVFSHMILFIKKKTDEDIIKRETDNGHDVFESFEQMEKTAF
VIPSAYGYDIKGYHVAPHDTPNTIIICHGVTMNVLNSLKYMHLFLDLGWNVLIYDHRRHG
QSGGKTTSYGFYEKDDLNKVVSLLKNKTNHRGLIGIHGESMGAVTALLYAGAHCSDGADF
YIADCPFACFDEQLAYRLRAEYRLPSWPLLPIADFFLKLRGGYRAREVSPLAVIDKIEKP
VLFIHSKDDDYIPVSSTERLYEKKRGPKALYIAENGEHAMSYTKNRHTYRKTVQEFLDNM
NDSTE
NT seq 918 nt   +upstreamnt  +downstreamnt
ttgaagaaaatccttttggccattggcgcgctcgtaacagctgtcatcgcaatcggaatt
gttttttcacatatgattctattcatcaagaaaaaaacggatgaagacattatcaaaaga
gagacagacaacggacatgatgtgtttgaatcatttgaacaaatggagaaaaccgctttt
gtgataccctccgcttacgggtacgacataaaaggataccatgtcgcaccgcatgacaca
ccaaataccatcatcatctgccacggggtgacgatgaatgtactgaattctcttaagtat
atgcatttatttctagatctcggctggaatgtgctcatttatgaccatcgccggcatggc
caaagcggcggaaagacgaccagctacgggttttacgaaaaggatgatctcaataaggtt
gtcagcttgctcaaaaacaaaacaaatcatcgcggattgatcggaattcatggtgagtcg
atgggggccgtgaccgccctgctttatgctggtgcacactgcagcgatggcgctgatttt
tatattgccgattgtccgttcgcatgttttgatgaacagcttgcctatcggctgagagcg
gaatacaggctcccgtcttggcccctgcttcctatcgccgacttctttttgaagctgagg
ggaggctatcgcgcacgtgaagtatctccgcttgctgtcattgataaaattgaaaagccg
gtcctctttattcacagtaaggatgatgactacattcctgtttcttcaaccgagcggctt
tatgaaaagaaacgcggtccgaaagcgctgtacattgccgagaacggtgaacacgccatg
tcatataccaaaaatcggcatacgtaccgaaaaacagtgcaggagtttttagacaacatg
aatgattcaacagaataa

DBGET integrated database retrieval system