KEGG   Bacillus subtilis subsp. subtilis 168: BSU24100
Entry
BSU24100          CDS       T00010                                 

Symbol
bkdR
Name
(RefSeq) sigma L-dependent transcriptional regulator YqiR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sigma54_activat PAS PAS_9 Sigma54_activ_2 PAS_4 HTH_8 PAS_8 PAS_10 AAA AAA_5 Mg_chelatase HTH_50 AAA_3 bpMoxR AAA_16 PglD_N DPCD TrkA_N HTH_30 DUF815 ThiF
Other DBs
NCBI-GeneID: 938666
NCBI-ProteinID: NP_390290
Pasteur: BG11721
BSORF: BG11721
UniProt: P54529 A0A6M3ZDU4
Position
complement(2504789..2506867)
AA seq 692 aa
MQKVLIVGAGKRGTALLHILIKTAIIDIIAVVDKDPEAPGLKEAEQYGIAVSSDWKPYIQ
QKPDIVIHTTGDQAVFDELLQRKHEDTIVMPGKMAYIVFQLMEEKQHLIQMLKEQTYKYD
RIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIKEVIPSTKMPRILKTRVP
EYNQKQLLGDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAVELAEEVTNLKQVRTMLEA
IIQSSDEAISVVDENGIGLLINKAYTKMTGLSEKEVIGKPANTDISEGESMHLKVLETRR
PVRGVRMKVGPNEKEVIVNVAPVIVDGILKGSVGVIHDVSEIKMLTAELNRARQIIRTLE
AKYTFDDIIGKSEQMLVALEQAKLGAKTPATILLRGESGTGKELFAHAIHNESDRKYNKF
IRVNCAALSENLLESELFGYEDGAFSGAKRGGKKGLFEEANNGSIFLDEIGELTQNMQAK
LLRVLQEKEIVRVGGTKAIPVNVRVIAATNVNIEKAMADGTFREDLYYRINRYPISIPPL
RQRLEDIEALSVRLIQKINRDYGRNVKGLSQQALRALSAYHWPGNVRELENVLGRAMIFL
NPHMEWIEKDHLPVFELEQKENDTDQGTGFDFPDIEGEKLSVAVEKFEAHLIQQTLEKHH
FNRTKTAKALGVSIRNLYYKMDKYGLANEGMQ
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgcaaaaggtactgatagtaggtgccggcaaaaggggaacggcgttattacatattctg
attaaaacagccatcatagatatcattgccgtagttgacaaagaccccgaggcgccggga
ttgaaagaagcagaacagtatgggattgccgtatcatctgattggaaaccttacatacaa
caaaaaccggatatcgtcattcatactaccggcgatcaagccgtgtttgacgagctcctt
caaagaaagcatgaagataccattgtcatgccgggaaaaatggcatacatcgtttttcag
ctgatggaagaaaagcagcacctgattcaaatgctaaaagagcaaacctataaatatgac
agaatttttaattccacccatgatggaatgatttttattgatatcaatgaagaaatcatt
ctctttaaccatatggccgaaaaaatggtcggaaaaaaacgtgaggaagtcattgggcgc
ccaataaaagaagtgattccgagcactaagatgccgcggattttaaaaacaagagtgcct
gaatacaaccagaagcagctgttaggcgatcatttgcaaattgtgaccacaagactgccg
attattgatgaaggcggacgtctgctcggggctctttgtgtgtttaaagatatcactgat
gcggtcgagctggcagaggaagtgaccaacttaaagcaggtccgtacgatgctggaggca
attattcaatcctccgatgaggcgatttctgtcgttgatgaaaacggcatcggcctgcta
atcaataaagcgtatacgaaaatgacggggctttctgaaaaagaagtcatcggcaagcct
gcaaacactgatatttccgaaggcgaaagcatgcatttaaaggtgcttgaaacaagacgt
cctgtccgcggtgtcagaatgaaggtcggcccgaatgaaaaagaagtgatcgttaatgta
gcaccggtgattgtggacgggattttgaaaggcagcgtcggcgtgattcacgatgtttcc
gaaattaaaatgctgacagcggagcttaatcgcgccagacaaattattcgcacgcttgaa
gcgaaatacacgtttgacgacattatcggcaaaagcgagcaaatgctggttgcgcttgag
caggcgaagctcggtgcgaaaacaccggcaaccatcttgctgcgcggggaatcaggaaca
ggaaaagaactgttcgcccatgccatccataacgaaagtgaccggaaatacaataaattt
attcgcgtgaattgtgcagccctttctgaaaacctgctcgaatcagaattgttcggctat
gaggatggtgcgttttcaggagcgaagcgcggcggtaaaaagggtttatttgaggaagca
aataacggcagtattttcttagatgaaatcggtgagctgacacaaaatatgcaggccaaa
ttgctacgcgtccttcaagaaaaggaaatcgtcagagtgggcggcacgaaagcgatccct
gtcaacgtcagagtgatcgcggcgacaaatgtaaatattgaaaaggcgatggcggacgga
acattccgggaagacctgtattaccggatcaatcgctatccgatctccatcccgcctttg
cggcagcggttggaggacattgaagcattgagcgtcagacttatccaaaagatcaaccgg
gattacggcaggaatgtaaaagggctctcacagcaagccttgcgcgccttatctgcctac
cattggcctgggaatgtccgggagcttgaaaatgtccttggacgagccatgatttttctg
aatccgcatatggaatggattgaaaaagatcacttgcctgtattcgaacttgagcaaaaa
gaaaatgacacagatcagggaacaggttttgattttccggatattgaaggcgaaaagctg
tctgtcgcagtagaaaaatttgaagcgcatttgatccagcaaacgcttgaaaagcatcat
tttaaccggacaaaaacagcaaaagctctcggtgtcagcattcggaatttatattacaaa
atggataaatatggccttgcaaatgaaggcatgcaataa

DBGET integrated database retrieval system