KEGG   Bacillus subtilis subsp. subtilis 168: BSU24300Help
Entry
BSU24300          CDS       T00010                                 

Gene name
xseA
Definition
(RefSeq) exodeoxyribonuclease 7 large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BSU24300 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU24300 (xseA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     BSU24300 (xseA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     BSU24300 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 938650
NCBI-ProteinID: NP_390310
Pasteur: BG11712
BSORF: BG11712
UniProt: P54521
Position
complement(2526920..2528266)
Genome map
AA seq 448 aa AA seqDB search
MGEAAYVTVSALTKYIKRKFDVDPHLENIWIKGELSNVKIHTRGHIYFTLKDENARMQSV
MFARQSERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKL
AGEGLFDDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENA
SRSIVTRIEEANEKEICDVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD
FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQKKERIQTLQS
SYAFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEALHPHEQLKQAR
TRYQEQTNQLRKNMNIQMKQLHSQFQTVLGKLNALSPLQVMERGYSLAYKEDKLIKSVSQ
IEEQDRLEIKLKDGVLTCEVLEKRGEEK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcagcgtatgtgaccgtctcagcgctgacaaagtatataaaacgaaaattc
gatgtagatcctcaccttgaaaatatttggattaaaggcgaattgtcgaatgtaaagata
cacacacgagggcatatttatttcactttaaaagacgaaaacgcaagaatgcagtcggtg
atgttcgcgagacaaagcgagcgtctgccttttaaacctgaaaacggaatgaaagtgctg
gtcagaggcggaatttccgtatatgaaccgagcggaaactatcaattatatgccaaagaa
atgcagcctgacggggttggagcgctttatttagcgtacgaagaattaaaaaagaagctt
gccggagaaggtttatttgacgaccgctacaaaaaacaaatccccgcatttccagccaca
atcggggttgtgacatctccaacgggtgccgctgtcagagacgttattacaactctaaaa
agaagatatccccttgtaaaagtcattgttcttccagcgctcgtacaaggtgaaaatgcg
agcagatccatcgttacgcgcattgaagaggcaaatgaaaaagagatttgcgacgtatta
attgtcgggagaggcggcggttcgatagaagaactgtgggcattcaatgaagaaattgta
gcacgcgccatctttgcttccaatattccgattatatcggcagtcggacatgagacggat
tttacgattagtgattttgtcgccgatatcagagctgcgacgccgacaggagcagctgag
attgctgtgcctcataccactgatttaatcgaacggacaaaaacagcggaagtcagaatg
acaagagcaatgcagcagcatctcggccagaaaaaagaacggatacaaacgctgcaatcg
tcctatgcctttcgttttccaaagcgtttgtatgcgcaaaaagagcagcagtttgacctc
gcgtaccagcagtttcaagcacagctgaccgctcttttagatcggaaaagcagacagctg
gagcgtgaaacgtacagattagaggcattgcatcctcatgaacagctgaaacaagcgaga
acacgataccaggaacaaacaaatcagctgagaaaaaatatgaatatccaaatgaagcag
ctgcattcccaatttcaaaccgttcttggcaagctgaatgcactaagtcctcttcaagtg
atggaaagaggatacagcttggcttataaagaagataaactcattaaaagtgtcagtcaa
atagaagagcaggaccggcttgaaatcaagctgaaggatggcgtgctgacctgtgaagta
ttagaaaagagaggggaagaaaaatga

DBGET integrated database retrieval system