KEGG   Bacillus subtilis subsp. subtilis 168: BSU24580
Entry
BSU24580          CDS       T00010                                 

Gene name
yqhH
Definition
(RefSeq) ATP-dependent helicase YqhH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII DEAD DUF2075 SWI2_SNF2 AAA_22 DUF1779
Other DBs
NCBI-GeneID: 938548
NCBI-ProteinID: NP_390338
Pasteur: BG11699
BSORF: BG11699
UniProt: P54509 A0A6M4JMC3
Position
2549775..2551448
AA seq 557 aa
MNTEMIYDAKWPEEFAERLKNDGPWANWELYKLSAEIQKTLAIPEFEGLRAPLYLPSFTP
LPHQLEVAQKVVEKMNGKAILADEVGLGKTVEAGLILKEYMIRGLAKKILILVPASLVSQ
WVKELQEKFLIPAVEQKKSYVWEQCDIVVSSIDTAKRSPHREIVLSIPYDLVIIDEAHKL
KNSKTKNYEFVRNLVKKYCLLLTATPIQNRIEEIFNLVSLLKPGHLGSQNHFQEEFAKKK
SSLEAHEHLKDLVNKVMIRNRRHDTGLNWKQRHVETVPIQFSPSEQALYDEISRLKDSIN
KPASMFSIMTLQRECCSSREAVYMTLKKMLDQKEKQAPAIDEDTISVLIDRINQVTQNSK
ALQVVDLIKKIDDKVIIFTEYRATQIYLQWFLQQNGISSVPFRGGFKRGKKDWMKDLFRG
KIQVLIATEAGGEGINLQFCNHMINYDLPWNPMRLEQRIGRIHRLGQERDVHIYNMATKH
TVEEHILKLLYEKIHLFEKVVGELDDILTKIQVNNFEEHLHDILYHSATEEEMKIKMDNL
TSFLSYKKQLPAEKRGS
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgaatacagaaatgatctacgatgcaaaatggcctgaagaatttgctgaaagactgaaa
aacgatggcccttgggcaaactgggaactgtacaagctctctgcagaaatccagaaaaca
ttagcaattccagagtttgaaggcttacgggctcctttatatctgccttcctttacgccg
ctcccccaccagcttgaagtggcgcaaaaagtggttgaaaaaatgaacgggaaagcgatt
ttagcagatgaggttggtctcggaaaaacggttgaagctggactgattctaaaagaatat
atgattcgcgggttagcaaaaaaaattttgatccttgtgcccgcttcccttgtgtcacag
tgggtcaaagagcttcaggaaaaatttttgattccggctgttgaacaaaagaaaagctat
gtgtgggagcaatgcgatattgtcgtctcatcaatagacaccgcgaagcgctcgccccat
cgagaaatcgttctgtctatcccatatgatcttgtcattattgatgaggcacacaaactg
aaaaatagcaaaacgaagaactatgaatttgtccggaatctcgtaaaaaaatattgcctg
cttcttaccgcgacgccaatccagaaccgtatcgaagagattttcaatttggtgtcctta
ttaaaacccggccatttaggcagtcagaatcactttcaggaggagttcgccaagaagaaa
tccagtttagaagcgcatgaacatttaaaagatcttgtgaataaagtcatgatccgtaac
aggcggcatgatacagggctgaattggaaacagcgccatgttgaaacagtgccgattcaa
ttttctccatcagagcaggcgctttatgatgaaatttctcgtttgaaggacagtatcaat
aaaccagccagcatgttctcgattatgaccttgcaaagagaatgctgttcgagcagagaa
gcggtatatatgacgctgaaaaagatgcttgatcaaaaagagaaacaagcacctgccatt
gatgaggatacgatttcagttttgatagatcgcatcaatcaagtgacacaaaactctaaa
gcgcttcaagttgttgacttgatcaaaaagatcgacgataaggtcatcatttttacagaa
taccgcgcaacccagatttatctgcagtggtttcttcagcaaaacggcatcagttctgtg
ccgtttagaggcggatttaaacgtggaaaaaaagactggatgaaggatcttttccgcgga
aaaatccaagtccttattgcaactgaagcaggcggtgagggaattaacctgcaattttgc
aatcacatgatcaactatgacctgccatggaacccgatgcggcttgagcaaagaatcgga
agaattcacagactcgggcaggagcgtgacgtgcatatttataacatggcgacaaaacat
acggtggaagagcatattctaaagcttttatatgaaaaaattcatttgtttgaaaaagtg
gtcggtgaacttgatgatattttaacgaaaattcaagtgaacaattttgaagagcacctt
catgacattttgtatcactcagcaacagaagaagaaatgaaaataaaaatggataactta
acctcatttttgtcttataaaaaacagctgcctgctgaaaaaagaggatcttag

DBGET integrated database retrieval system