KEGG   Bacillus subtilis subsp. subtilis 168: BSU25290
Entry
BSU25290          CDS       T00010                                 

Symbol
era
Name
(RefSeq) GTPase Era
  KO
K03595  GTPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25290 (era)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU25290 (era)
Ribosome biogenesis [BR:bsu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BSU25290 (era)
 Prokaryotic type
  GTPases
   BSU25290 (era)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU25290 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU Dynamin_N PduV-EutP RsgA_GTPase AIG1 MMR_HSR1_Xtn cobW Ras SpoIVA_ATPase Roc AAA_22
Other DBs
NCBI-GeneID: 937871
NCBI-ProteinID: NP_390407
Pasteur: BG11188
BSORF: BG11188
UniProt: P42182 A0A6M4JLW8
Position
complement(2610041..2610946)
AA seq 301 aa
MTNESFKSGFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRNKVQGVLTTGTSQTIF
IDTPGIHKPKHKLGDFMMKVAQNTLKEVDLILFMINAEEGYGKGDEFIIEKLQTMSTPVF
LIVNKIDKIHPDQLLLLIDEYRKRYPFKEIVPISALEGNNIETLLAQIEAYLPEGPQFYP
SDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKGQDNGSVHVAATIVVERDS
QKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVKVQKDWRNKMSQLRDFGFKEDE
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
atgacgaacgaaagctttaaatcaggatttgtatccattattggaagaccaaacgtagga
aaatctacatttttgaacagagtcattggacaaaaaatcgcgatcatgagcgataagccc
caaacgacgagaaacaaggtgcaaggagtactgacgacaggcacatcacaaaccattttt
attgacacaccagggattcataaacctaagcataaacttggggactttatgatgaaagtg
gcgcaaaatacattaaaagaagtcgatttgatcttgtttatgatcaatgctgaggaaggc
tacgggaagggcgacgaattcatcattgagaaattgcagacgatgtctacgcctgtattc
ttaatcgtaaacaaaattgataaaattcatcccgaccaattgcttctgctaattgacgaa
taccgcaaacgttatccttttaaggaaattgttccgatttctgctttagaaggaaataac
atcgaaaccttgctcgcgcagatcgaagcgtatttgccggaagggccgcaattctatccg
agtgaccaggtaactgaccaccctgaacgatttatcatttctgaattaatcagggaaaag
gtgctgcatttgacgagagaagaaatcccgcacagcattgcggtggccatcgaatccatc
aaagggcaggacaacggttctgtgcacgtagcggcaacgattgtggtcgagcgggattcc
cagaaaggcatcgtgatcggtaaaaaaggaagccttctaaaagaggttggaaaaagagcg
agagcggatattgaagcactgttgggctcccgtgtctaccttgaattgtgggtgaaagtg
cagaaagactggcgtaataaaatgtcccagcttcgcgattttggctttaaagaggacgaa
tattaa

DBGET integrated database retrieval system