KEGG   Bacillus subtilis subsp. subtilis 168: BSU25340
Entry
BSU25340          CDS       T00010                                 

Gene name
phoH
Definition
(RefSeq) PhoH-like protein
  KO
K06217  phosphate starvation-inducible protein PhoH and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU25340 (phoH)
SSDB
Motif
Pfam: PhoH AAA_30 AAA_19 IstB_IS21 UvrD-helicase AAA_25 AAA_22 DEAD
Other DBs
NCBI-GeneID: 937868
NCBI-ProteinID: NP_390412
Pasteur: BG11337
BSORF: BG11337
UniProt: P46343 A0A6M4JNQ1
Position
complement(2614496..2615455)
AA seq 319 aa
MTEHLLAMNQKLKNPDEALSLFGNQDSFLKLMEKDLNLNIITRGETIYVSGDDESFQIAD
RLLGSLLALIRKGIEISERDVIYAIKMAKKNELEYFESMYEEEITKNAKGKSIRVKTMGQ
REYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKIILTRPAVEAGESLGFLP
GDLKEKVDPYLRPLYDALHDVLGADHTERLMERGIIEIAPLAYMRGRTLDDAYVILDEAQ
NTTPAQMKMFLTRLGFGSKMIITGDVSQIDLPKGVKSGLAVAKEMLKGIDGISMIELDQT
DVVRHPLVAKIIEAYDKQN
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacagaacatttacttgcgatgaatcaaaaactgaaaaacccggacgaggcgctttca
ctcttcgggaaccaagattcttttttgaaattgatggagaaagatctgaatttaaatatc
attacgcgcggcgagacgatttatgtttcaggcgatgatgaatcgtttcagattgcagac
aggctgctgggatcgctcctcgctttaattcgcaaggggatagagatctctgaacgtgat
gtgatttacgccatcaaaatggcaaagaagaatgaacttgaatactttgaaagcatgtat
gaagaagaaattacaaaaaacgcaaaaggcaaatcaatccgtgtaaaaacaatgggacag
cgggaatacgtggccgctatgaagcggaatgaccttgtattcggcattggtccggcggga
accgggaaaacgtacctggctgtcgtaaaagcagtccatgctttaaaaaacggacatatc
aaaaaaatcattttaacaagacctgccgtggaagccggtgaaagccttggttttctccca
ggtgacctaaaagaaaaagtagatccttatttgcgcccgctgtatgacgctctccatgat
gtgcttggggcagatcatacagaacgtctgatggaaagaggcatcattgaaattgctccg
ctcgcatatatgaggggacggacgctcgatgatgcttatgttatacttgatgaagcacag
aataccacgcctgctcaaatgaaaatgtttttgacgagactgggttttggctctaaaatg
atcattacaggtgacgttagccaaattgatctgccgaaaggcgtcaaatcgggacttgca
gtagcgaaggagatgctgaaaggaatagacggcatttctatgattgagctagaccagaca
gacgtggtcagacatccgcttgttgcgaaaattattgaagcatacgataagcaaaattaa

DBGET integrated database retrieval system