KEGG   Bacillus subtilis subsp. subtilis 168: BSU25460
Entry
BSU25460          CDS       T00010                                 

Gene name
dnaJ
Definition
(RefSeq) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU25460 (dnaJ)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU25460 (dnaJ)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP40 / DNAJ
   BSU25460 (dnaJ)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BSU25460 (dnaJ)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP DUF5351 SRR zf-RING_10
Other DBs
NCBI-GeneID: 937848
NCBI-ProteinID: NP_390424
Pasteur: BG10665
BSORF: BG10665
UniProt: P17631
Position
complement(2624785..2625912)
AA seq 375 aa
MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINKEAGSDEKFKEVKEAYETLSDDQ
KRAHYDQFGHTDPNQGFGGGGFGGGDFGGFGFDDIFSSIFGGGTRRRDPNAPRQGADLQY
TMTLSFEDAAFGKETTIEIPREETCETCKGSGAKPGTNPETCSHCGGSGQLNVEQNTPFG
KVVNRRVCHHCEGTGKIIKNKCADCGGKGKIKKRKKINVTIPAGVDDGQQLRLSGQGEPG
INGGPAGDLFVVFHVRAHEFFERDGDDIYCEMPLTFAQAALGDEVEVPTLHGKVKLKIPA
GTQTGTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTDKQKDIIREFAEVSGNLPDEQ
EMSFFDKVKRAFKGD
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagtaagcgtgattactatgaagtgctgggagtaagtaagagcgcttcaaaggatgaa
attaaaaaagcttatcggaagctgtcaaaaaaatatcatcctgatattaacaaagaagcc
ggatcagatgaaaaatttaaagaggtaaaagaagcatacgaaacgctgtcagatgaccaa
aaacgtgcgcattacgatcaatttggtcacactgaccctaaccaaggcttcggcggcgga
ggttttggcggcggcgatttcggcggttttggtttcgatgatattttctcaagtatattc
ggcggaggcacaagacgaagagatccaaacgctccgcgccagggtgctgatttacagtat
acgatgaccctgtcgtttgaggatgcggctttcggtaaagaaacaaccatcgaaattccc
cgcgaggaaacgtgcgaaacatgtaaaggctcaggtgcgaaacctggaacaaatccagaa
acatgctcccactgcggaggctccggccagttaaacgtggagcaaaatacaccgtttgga
aaagtcgttaacagacgggtctgccaccactgtgaaggtacaggcaaaatcattaaaaac
aaatgtgcggactgcggcggcaaaggaaaaatcaaaaaacgcaagaaaatcaatgtgaca
attccagccggtgtagatgacgggcagcagcttcgtctctcgggacagggtgaaccagga
ataaacggcggccctgccggggatttatttgtcgtgttccatgtacgcgcacacgagttc
ttcgagcgtgacggcgatgatatttactgtgaaatgccgttaacgtttgctcaggctgct
cttggagatgaggtagaagtgccgacgctgcatggaaaagtgaaattgaaaattccggcc
ggtacacaaacaggaacgaaattcagattaagaggcaaaggcgttcaaaatgtcagaggc
tatggacagggtgaccagcatatcgtcgtccgcgtcgttacgccgacaaatctgactgat
aaacaaaaagacattatccgcgaatttgccgaagtcagcggaaacctgcctgacgaacag
gaaatgagtttctttgacaaggtaaaacgcgcgtttaaaggcgattaa

DBGET integrated database retrieval system