KEGG   Bacillus subtilis subsp. subtilis 168: BSU25900Help
Entry
BSU25900          CDS       T00010                                 

Gene name
cwlA
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase CwlA
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25900 (cwlA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU25900 (cwlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2 PG_binding_1
Motif
Other DBs
NCBI-GeneID: 937772
NCBI-ProteinID: NP_390467
Pasteur: BG10505
BSORF: BG10505
UniProt: P24808
Position
complement(2664573..2665391)
Genome map
AA seq 272 aa AA seqDB search
MAIKVVKNLVSKSKYGLKCPNPMKAEYITIHNTANDASAANEISYMKNNSSSTSFHFAVD
DKQVIQGIPTNRNAWHTGDGTNGTGNRKSIGVEICYSKSGGVRYKAAEKLAIKFVAQLLK
ERGWGIDRVRKHQDWNGKYCPHRILSEGRWIQVKTAIEAELKKLGGKTNSSKASVAKKKT
TNTSSKKTSYALPSGIFKVKSPMMRGEKVTQIQKALAALYFYPDKGAKNNGIDGVYGPKT
ADAIRRFQSMYGLTQDGIYGPKTKAKLEALLK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagttgtaaagaatctagtctctaaatcaaagtatggattgaaatgtcct
aatccaatgaaagctgaatatatcactattcataacactgcgaatgatgcttcagcagcc
aatgagatttcttacatgaagaataactctagctcaacaagttttcactttgcagtagac
gataaacaagtcattcaaggtattccaacgaatcgtaacgcttggcacacaggagatgga
acaaacggtacagggaatcgcaagtctattggtgtcgaaatttgttatagcaagtcagga
ggggtacgatataaggcagcggaaaagcttgctattaagtttgtggctcagctacttaaa
gaacgtggatggggtattgatcgagtccgcaaacatcaagactggaatggtaagtattgc
ccgcaccgcattttgtcagagggaagatggattcaagttaagactgcaattgaagcagaa
ttgaaaaagttgggcggaaaaacaaactcaagcaaagcaagtgtagctaaaaagaaaaca
acaaacacaagcagcaaaaaaacgtcatatgcgctaccatccggtatttttaaagtgaag
agcccaatgatgagaggggaaaaggtaacacaaattcaaaaagcactggctgcactatac
ttttacccggataaaggagcaaaaaacaacggcattgacggcgtgtatggtccgaaaaca
gcagatgcaattagacgattccagtctatgtacgggcttactcaagacggtatttacgga
ccaaaaacgaaagcgaaacttgaagctctcttgaagtaa

DBGET integrated database retrieval system