KEGG   Bacillus subtilis subsp. subtilis 168: BSU25960
Entry
BSU25960          CDS       T00010                                 

Symbol
yqcB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4122 HK
Other DBs
NCBI-GeneID: 937762
NCBI-ProteinID: NP_390473
Pasteur: BG11293
BSORF: BG11293
UniProt: P45937 A0A6M3ZE43
Position
complement(2668493..2668765)
AA seq 90 aa
MITQLYRERTAADLKNRISKVLLNGNETEIVELTIQGAVVTVLTQREEDIKHIKSVQILD
DQNNVITERTTDLDVSNNRTLDFRITFEVV
NT seq 273 nt   +upstreamnt  +downstreamnt
atgattacacagctttatagagagcgtacagctgcagatttgaaaaatagaatatcgaaa
gtgctgctgaatggaaatgaaacagaaattgtggaactcaccattcagggtgccgttgtc
acggtgcttactcaacgagaggaagacatcaaacatattaagagtgttcagatacttgat
gatcaaaacaacgtgattacggaaagaacaacagatttagacgttagtaataatagaacg
ctagattttaggattacttttgaggtggtttaa

DBGET integrated database retrieval system