KEGG   Bacillus subtilis subsp. subtilis 168: BSU25960Help
Entry
BSU25960          CDS       T00010                                 

Gene name
yqcB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HK
Motif
Other DBs
NCBI-GeneID: 937762
NCBI-ProteinID: NP_390473
Pasteur: BG11293
BSORF: BG11293
UniProt: P45937
Position
complement(2668493..2668765)
Genome map
AA seq 90 aa AA seqDB search
MITQLYRERTAADLKNRISKVLLNGNETEIVELTIQGAVVTVLTQREEDIKHIKSVQILD
DQNNVITERTTDLDVSNNRTLDFRITFEVV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgattacacagctttatagagagcgtacagctgcagatttgaaaaatagaatatcgaaa
gtgctgctgaatggaaatgaaacagaaattgtggaactcaccattcagggtgccgttgtc
acggtgcttactcaacgagaggaagacatcaaacatattaagagtgttcagatacttgat
gatcaaaacaacgtgattacggaaagaacaacagatttagacgttagtaataatagaacg
ctagattttaggattacttttgaggtggtttaa

DBGET integrated database retrieval system