KEGG   Bacillus subtilis subsp. subtilis 168: BSU26110
Entry
BSU26110          CDS       T00010                                 

Symbol
yqbH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3599
Other DBs
NCBI-GeneID: 937727
NCBI-ProteinID: NP_390488
Pasteur: BG11279
BSORF: BG11279
UniProt: P45924 A0A6M3ZEF2
Position
complement(2682127..2682489)
AA seq 120 aa
MSYQSLLTHRCDIYHLQEKKENRKQKFGVPVEDVQPVFSYPDEPDIENQPCYFTEKSQSI
IQQESNVSIYQSFLVHFPATADIRVNDRAVWDGTAYKLQKPRKIRNHHWEVTAVREVEYL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagttatcaatccttattgactcacagatgtgacatttaccatctgcaggagaaaaaa
gaaaatagaaagcaaaaattcggggtgccggttgaagatgttcaaccggttttttcgtac
cctgatgagccggacatagaaaatcagccgtgttattttacagagaagagtcagtccatt
atccaacaggagtcaaatgtatctatttatcaatctttccttgtgcatttccctgctact
gctgatattcgagtaaatgacagggcggtttgggatggtactgcttataaattacagaag
ccccgcaaaatcaggaatcatcattgggaagtgacggcagtacgggaggttgaatactta
tga

DBGET integrated database retrieval system