KEGG   Bacillus subtilis subsp. subtilis 168: BSU26140
Entry
BSU26140          CDS       T00010                                 

Symbol
yqbE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_capsid Phage_cap_P2 SAM_Exu DUF2357 VirC2
Other DBs
NCBI-GeneID: 937722
NCBI-ProteinID: NP_390491
Pasteur: BG11276
BSORF: BG11276
UniProt: P45921 A0A6M4JLB8
Position
complement(2683207..2684142)
AA seq 311 aa
MRNQEVINKAEMTLSTLESGGIMNPTQASTFIRMVQDTPTILRDARVIQMDHDTQKIEKI
GFGQRILRAAQEGVALTKDQKSVPSTSTVNLSTKEVIAEVNITYDTLENNIEKDGLQNTI
MQMIAERAAVDIEELLVNGDTSSSDSYLAQLDGIRKQATSHIVDAAGEELTRQTFKRGYK
AVPPKYLRIPQEFRFYTSPGIEVEWKDRVADRQTNLGDAAVQGGLSSAFGVPIKGIANLQ
PYTIGEGDTAADVSDIILTHPKNIILGFSRNIRIEVDKDIRRRMFIIVLTAKLDSVFEEE
DAVAKIVKVKE
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagaaatcaagaggttattaataaagcagaaatgacgctttctactttagagagcggc
gggattatgaatcctactcaggcttcaacttttattcgaatggtacaagatacgccaacc
attttaagagatgcgcgagttattcaaatggaccatgacacacagaaaatcgagaagatc
ggttttggtcagcgtattttaagggcagcccaagagggagttgcgctaactaaagatcaa
aagtcagttccatcaactagcacagttaacttaagcacaaaagaagtaattgctgaagtt
aacattacctatgacacacttgaaaacaacatcgaaaaagatggccttcagaatacaatc
atgcaaatgatagctgagcgtgctgcggttgatattgaagagttgcttgtaaatggggat
acatcttcctccgactcatatcttgcacaattagatggcatcagaaaacaagctacatct
catattgtcgatgctgcaggtgaggaactgacacgtcaaacatttaaacgaggatacaaa
gctgtacctcctaaatatttgcgaattccgcaggagttccgtttctatacatcgcctggt
attgaggtcgaatggaaagatcgtgtagctgatcgtcaaacaaatttaggggatgcagct
gttcaaggtggcctttcatctgcttttggtgttccaatcaaaggtattgcaaatttacag
ccttatacgattggagagggagatactgcagccgatgtttctgatatcatcctaactcat
ccgaagaatattattctcggattctctcgtaacattcggattgaagtagataaggacatc
cgtcgccgtatgtttatcattgttttgacagcgaaattggatagtgtttttgaagaagag
gacgccgtagccaagatcgtgaaagtgaaggagtag

DBGET integrated database retrieval system