KEGG   Bacillus subtilis subsp. subtilis 168: BSU26200
Entry
BSU26200          CDS       T00010                                 

Symbol
yqaS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_terminase HTH_23 HTH_28 Terminase_5 Sigma70_r4_2 HTH_36 HTH_3 HTH_Tnp_1 HTH_10 HTH_29 HTH_26 DUF1323
Other DBs
NCBI-GeneID: 937704
NCBI-ProteinID: NP_390497
Pasteur: BG11270
BSORF: BG11270
UniProt: P45915 A0A6M3ZHI6
Position
complement(2689594..2690313)
AA seq 239 aa
MVDKHIQAYKDYAKGMKYKDLAEKYGVSVNTIKSWKQRHGWQRKKGAPLKKGVHTKKVGA
PLGNKNALGNNGGAPKGNQNAVTHGFFSKFLPEETLSIMEGIQERSPVDMIWDQIQIQYA
AIIRAQKIMFVSDKQEMIKELKKKKSVLSETNEVEEEEFEFQFSWDRHATFLNAQSRAMA
ELRNLIKQFDELAHSEDERRLKLEHMRLNINKKKIEIEELTEEDKPFEITIVNKGDDSD
NT seq 720 nt   +upstreamnt  +downstreamnt
atggttgataagcacatacaggcgtataaggattacgccaaaggtatgaaatacaaggac
cttgccgagaaatatggggtatctgtgaacaccattaaatcgtggaaacaacgccatggt
tggcaaagaaaaaagggtgcacccttaaaaaaaggtgtgcacacaaaaaaagtaggtgca
ccactcggtaacaagaatgcgttaggtaataatggcggcgcacctaagggaaatcaaaac
gctgtgactcatggattcttctctaagttcctgccagaagaaacgctatccatcatggaa
gggattcaagaacgttcgcctgtcgatatgatatgggatcagatacagatccaatatgcc
gcaataataagggcgcaaaagatcatgttcgtttctgataagcaggaaatgattaaagaa
ctgaaaaagaaaaagtctgtgctatctgagacaaacgaagtcgaagaggaagaattcgaa
tttcaattttcttgggatcgtcatgcaacgttcttgaacgctcaatctcgtgcaatggca
gagctcaggaatttaattaaacagtttgatgaattagcccattcggaagacgaacgacgc
cttaaattggagcatatgcgcttaaatatcaacaagaaaaaaatagagatcgaagaactt
acagaagaagataaaccttttgagatcaccattgtaaacaaaggtgatgacagtgattaa

DBGET integrated database retrieval system