KEGG   Bacillus subtilis subsp. subtilis 168: BSU26320
Entry
BSU26320          CDS       T00010                                 

Symbol
yqaG
Name
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_31 AbiJ_NTD4
Other DBs
NCBI-GeneID: 937671
NCBI-ProteinID: NP_390509
Pasteur: BG11258
BSORF: BG11258
UniProt: P45904 A0A6M3ZEU8
Position
complement(2697673..2698242)
AA seq 189 aa
MENNPYNMRNLPQIMRSARKAAGLSQYQIGKLIGGKDQRYVSDVENGLAKLTPELCIKWF
EKCAAYEHIDLVHYLFKLHPTAAAPIDPALNECASNAVINMVHQLEEALQATKHLARWLT
DNRPGKTEELPMADIKQIFDLIAANKTLIYSLVRTHGLKMQELADRWTRKALVDQVAMAK
QEGRQAVSV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggagaacaacccatacaatatgcgtaatttaccgcagattatgcgtagtgcccgtaag
gctgcaggtctttcacaataccaaatcggcaagttaatcggaggtaaggatcaaaggtat
gtttcagatgttgaaaatggacttgccaagcttactccagagttatgtattaaatggttt
gagaagtgcgctgcctatgaacatattgatcttgtacattacttattcaaacttcatcct
acagccgctgctcctattgatccggcactcaatgaatgtgcaagtaatgcggtgattaat
atggttcaccaattggaggaagcactgcaagcaaccaaacatttagcccgttggctcacg
gataaccgaccaggtaaaacagaggagctgccgatggccgatattaagcagatttttgat
ttgattgcggctaacaaaacattgatttattcacttgttcgtactcacgggttgaaaatg
caggaacttgcagatagatggacgcggaaagctctagttgatcaagttgctatggcaaaa
caagaaggaaggcaggcggtttcagtatga

DBGET integrated database retrieval system