KEGG   Bacillus subtilis subsp. subtilis 168: BSU26340Help
Entry
BSU26340          CDS       T00010                                 

Gene name
yqaF
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_25
Motif
Other DBs
NCBI-GeneID: 937684
NCBI-ProteinID: NP_390511
Pasteur: BG11257
BSORF: BG11257
UniProt: P45903
Position
complement(2698486..2698716)
Genome map
AA seq 76 aa AA seqDB search
MMRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIVSKKIGEKLGFDWTIF
FEDVCNETKHNSKDSA
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaaatggcttaagaaaaaccgcttagaaaaagggtttactcaagaagaagtt
gccaaagctgcacagattggtagagcatactacaccatgatagaaaatggtactaggaag
cctagtgttattgtctcaaaaaaaataggagagaaattaggctttgactggactattttt
tttgaggatgtatgtaacgaaacgaaacataattctaaggattcagcatga

DBGET integrated database retrieval system