KEGG   Bacillus subtilis subsp. subtilis 168: BSU26360
Entry
BSU26360          CDS       T00010                                 

Symbol
yqaD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6548 Orf78 DUF6584 ETRAMP SARAF
Other DBs
NCBI-GeneID: 937674
NCBI-ProteinID: NP_390513
Pasteur: BG11255
BSORF: BG11255
UniProt: P45901 A0A6M3ZEM8
Position
complement(2699510..2699677)
AA seq 55 aa
MKNNDKKKEVQRKYREEIKKKKQKNEDNKNFIKETIIVVTIIVLFIFFTYTLQGF
NT seq 168 nt   +upstreamnt  +downstreamnt
atgaaaaataatgataagaagaaagaggttcaaagaaaatacagagaagagattaaaaaa
aagaaacaaaagaatgaagataataaaaattttattaaagaaacaattattgttgttacg
ataattgtattgtttatttttttcacatacactttgcaaggtttttaa

DBGET integrated database retrieval system